Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Asp/Glu-ADT subunit B; EC 6.3.5.- (characterized)
to candidate WP_020175311.1 A3OQ_RS0110325 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
Query= SwissProt::Q9RF06 (475 letters) >NCBI__GCF_000385335.1:WP_020175311.1 Length = 495 Score = 412 bits (1059), Expect = e-119 Identities = 215/478 (44%), Positives = 308/478 (64%), Gaps = 10/478 (2%) Query: 3 FETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRA 62 +E ++G+E H ++ + SK+FS + FG +PNSN +++D A PG+LPV+N+ V A+R+ Sbjct: 18 WEVIVGIETHAQVTSRSKLFSGASTTFGNDPNSNVSLVDAAMPGMLPVINEECVAQAVRS 77 Query: 63 AMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDG-ETKRIGITRL 121 + L I S FDRKNYFYPD P+ YQISQ+ PI G + ++V E +GI RL Sbjct: 78 GLGLKAHINLRSTFDRKNYFYPDLPQGYQISQYKTPIVGEGIVTVDVSPTEQIEVGIERL 137 Query: 122 HMEEDAGKSTH--KGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQYTGV 179 H+E+DAGKS H S VDLNR G L+EIVS+PD+RS ++A AY+ KLR+I++Y G Sbjct: 138 HLEQDAGKSLHDQSATDSFVDLNRSGVALMEIVSKPDMRSSEQARAYVTKLRTILRYLGT 197 Query: 180 SDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEELLSGG 239 D ME+GSLR D N+S+R G E FGT+ E+KN+NS ++ + +E E +RQ L GG Sbjct: 198 CDGNMEQGSLRADVNVSVRRPG-EPFGTRCEIKNVNSIRFIGQAIEVEARRQIGILEDGG 256 Query: 240 EIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDER 299 +I QETR FD G+T MR KE + DYRYFP+PD++PL D A+ + + +PELPD + Sbjct: 257 KIDQETRLFDPGKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQAYVDALAADLPELPDAK 316 Query: 300 KAKYVNELGLPAYDAHVLTLTKEMSDFFESTIEHGA---DVKLTSNWLMGGVNEYLNKNQ 356 KA+++ E GLPAYDA VL +E +DF+E+T++HG D K +NW++G V Y N Sbjct: 317 KARFMTEYGLPAYDAGVLVADRETADFYETTVKHGGKARDAKAIANWILGDVAAYANSIG 376 Query: 357 VELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPELAA--KGGNAKQIMEDNGLVQISD 414 V L T ++P +AG++ LI DGT+S KIAK V + A K + ++E G+ Q++D Sbjct: 377 VPLYQTHISPAQIAGIVDLISDGTISGKIAKDVLALIIAEEKEAHPAALVEARGMRQVTD 436 Query: 415 EATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQEL 472 + V++ + N V K +G+ VGQ+MK + G+ANPQ VN LLK +L Sbjct: 437 LGAIETAVDQIIAANPDKVAQ-AQAKPSMLGWFVGQVMKQTGGKANPQAVNDLLKAKL 493 Lambda K H 0.313 0.133 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 639 Number of extensions: 31 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 475 Length of database: 495 Length adjustment: 34 Effective length of query: 441 Effective length of database: 461 Effective search space: 203301 Effective search space used: 203301 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 52 (24.6 bits)
Align candidate WP_020175311.1 A3OQ_RS0110325 (Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B)
to HMM TIGR00133 (gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit (EC 6.3.5.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00133.hmm # target sequence database: /tmp/gapView.18771.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00133 [M=481] Accession: TIGR00133 Description: gatB: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, B subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-160 520.1 0.0 2.7e-160 519.9 0.0 1.0 1 lcl|NCBI__GCF_000385335.1:WP_020175311.1 A3OQ_RS0110325 Asp-tRNA(Asn)/Glu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000385335.1:WP_020175311.1 A3OQ_RS0110325 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 519.9 0.0 2.7e-160 2.7e-160 3 480 .. 17 493 .. 15 494 .. 0.96 Alignments for each domain: == domain 1 score: 519.9 bits; conditional E-value: 2.7e-160 TIGR00133 3 eyelviGlEvHvqlntksKlFckcsneaqeakpNtnvcpvclglPGalPvlNkeavkkAlklalalnsk 71 ++e+++G+E+H q+ +sKlF+ +s+ + + pN+nv+ v+ ++PG lPv+N+e v++A+ +l l+++ lcl|NCBI__GCF_000385335.1:WP_020175311.1 17 DWEVIVGIETHAQVTSRSKLFSGASTTFGN-DPNSNVSLVDAAMPGMLPVINEECVAQAVRSGLGLKAH 84 6799**************************.9************************************* PP TIGR00133 72 ivsevsvFdRKhYfYpDlPkgyqitqqdlPiaedGkleieleeke.keigierlhlEeDtgksqykesd 139 i+ s+FdRK+YfYpDlP+gyqi+q+++Pi+ +G ++++++ +e e+gierlhlE+D+gks + +s lcl|NCBI__GCF_000385335.1:WP_020175311.1 85 IN-LRSTFDRKNYFYPDLPQGYQISQYKTPIVGEGIVTVDVSPTEqIEVGIERLHLEQDAGKSLHDQSA 152 77.59***********************************98877369******************875 PP TIGR00133 140 kdkqslvDfNRsgvPLlEiVtkPdlksakearaflkklrqilryleisdgdleeGsmRvDvNvsirlkG 208 + s+vD+NRsgv L+EiV+kPd++s+++ara++ klr+ilryl+ dg++e+Gs+R+DvNvs+r lcl|NCBI__GCF_000385335.1:WP_020175311.1 153 --TDSFVDLNRSGVALMEIVSKPDMRSSEQARAYVTKLRTILRYLGTCDGNMEQGSLRADVNVSVRRP- 218 ..799*************************************************************55. PP TIGR00133 209 qekegtrvEiKNlnslksiekaieyEieRqkkllkkgeevkqetrafdekksitvslRkKeeseDYRYf 277 e +gtr EiKN+ns++ i +aie E Rq+ +l++g ++ qetr fd k t s+R+Kee++DYRYf lcl|NCBI__GCF_000385335.1:WP_020175311.1 219 GEPFGTRCEIKNVNSIRFIGQAIEVEARRQIGILEDGGKIDQETRLFDPGKGETRSMRSKEEAHDYRYF 287 6789***************************************************************** PP TIGR00133 278 pePdlppieideevvkekveeklpelPeakrirlkkeyglseedakvlvsdlelldafeevvklikep. 345 p+Pdl p+e+d+ +v+ +++ lpelP+ak++r+++eygl ++da vlv+d+e +d +e+ vk +++ lcl|NCBI__GCF_000385335.1:WP_020175311.1 288 PDPDLLPLEFDQAYVDA-LAADLPELPDAKKARFMTEYGLPAYDAGVLVADRETADFYETTVKHGGKAr 355 ****************9.********************************************9988877 PP TIGR00133 346 ..klavnWileellgeLnkkkislaeallkpeelaeliklikegkisqksakelleellen..kkdpkk 410 k+ +nWil +++++ n+ ++l+++ ++p ++a +++li++g+is+k+ak++l ++ + + +p + lcl|NCBI__GCF_000385335.1:WP_020175311.1 356 daKAIANWILGDVAAYANSIGVPLYQTHISPAQIAGIVDLISDGTISGKIAKDVLALIIAEekEAHPAA 424 77999*****************************************************9884456789* PP TIGR00133 411 lieklgliqisdekelvkiveevikenpkevekyksgkekalkflvGqvmkktkgradpkevekllkel 479 l+e++g+ q++d ++ +v+++i+ np++v + + k ++l+++vGqvmk+t g+a+p+ v+ llk + lcl|NCBI__GCF_000385335.1:WP_020175311.1 425 LVEARGMRQVTDLGAIETAVDQIIAANPDKVAQAQ-AKPSMLGWFVGQVMKQTGGKANPQAVNDLLKAK 492 *******************************9865.6789**************************988 PP TIGR00133 480 l 480 l lcl|NCBI__GCF_000385335.1:WP_020175311.1 493 L 493 7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (481 nodes) Target sequences: 1 (495 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 11.15 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory