GapMind for Amino acid biosynthesis

 

Alignments for a candidate for aroL in Methyloferula stellata AR4T

Align Shikimate kinase; SK; EC 2.7.1.71 (uncharacterized)
to candidate WP_026595427.1 A3OQ_RS0102670 Holliday junction branch migration DNA helicase RuvB

Query= curated2:A8LY07
         (167 letters)



>NCBI__GCF_000385335.1:WP_026595427.1
          Length = 348

 Score = 45.8 bits (107), Expect = 8e-10
 Identities = 26/56 (46%), Positives = 32/56 (57%), Gaps = 9/56 (16%)

Query: 6   VLVGPPGSGKTTVGQALAELLGVEFRDT---------DLDVEATAGKPISEIFIDE 52
           + VGPPG GKTT+ Q +A  LGV FR T         DL  + TA +P   +FIDE
Sbjct: 58  LFVGPPGLGKTTLAQIVARELGVNFRSTSGPVIAKAGDLAAQLTALEPRDVLFIDE 113


Lambda     K      H
   0.318    0.134    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 141
Number of extensions: 9
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 167
Length of database: 348
Length adjustment: 23
Effective length of query: 144
Effective length of database: 325
Effective search space:    46800
Effective search space used:    46800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory