Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_051149830.1 H035_RS0108005 aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000421465.1:WP_051149830.1 Length = 373 Score = 260 bits (664), Expect = 5e-74 Identities = 148/364 (40%), Positives = 202/364 (55%), Gaps = 4/364 (1%) Query: 23 AAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQ 82 A E Q T +V++ G+P P+P+ A + ++ Y+ A G+P+LR+AIAA Y+ Sbjct: 9 ALEAQGT--SVVHMEIGEPDFPTPDPIAQAGMETIAKGRVQYTPAAGLPQLREAIAAFYR 66 Query: 83 RRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEI 142 +R+GI + P+ V +T G+SG FLLA ++G RV M PGYPC R+ + G + Sbjct: 67 QRYGIRIAPERVFLTPGASGAFLLALSLLLESGKRVLMTDPGYPCNRHFVHLFGGIPDAV 126 Query: 143 PCGPQTRFQPTAQMLAEI-DPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLIS 201 P TRF T ++ E P GV +ASPANPTGTVI P+ELA I + + LIS Sbjct: 127 PVTADTRFHLTETLVREYWRPETVGVWLASPANPTGTVIDPDELARICRAVASKNGFLIS 186 Query: 202 DEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTG 261 DE+YHGL Y G S A + + VVNSFSKY+ MTGWRLGWL+VP A + + Sbjct: 187 DEIYHGLEYHGGRCVS-ALEVAERVFVVNSFSKYFGMTGWRLGWLVVPEAFIDAAERVAQ 245 Query: 262 NFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFY 321 N I P SQ AA++AF P + + R L D L +G GAFY Sbjct: 246 NIFISAPTHSQYAALAAFEPRTLDILEARRRRFEDRRDFLYDALCSLGFKMGGKPRGAFY 305 Query: 322 VYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAGPSGDIEEALRRI 381 +YAD SDFT+DS F LL GVA+ PG DF A ++VR ++ + E + RI Sbjct: 306 LYADCSDFTADSYRFALALLDRAGVAVTPGCDFGRAGASAYVRFAYTVELEALREGVERI 365 Query: 382 GSWL 385 ++L Sbjct: 366 AAFL 369 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 443 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 373 Length adjustment: 30 Effective length of query: 358 Effective length of database: 343 Effective search space: 122794 Effective search space used: 122794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory