Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_028322003.1 H567_RS0114825 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000422285.1:WP_028322003.1 Length = 432 Score = 165 bits (418), Expect = 3e-45 Identities = 135/413 (32%), Positives = 209/413 (50%), Gaps = 43/413 (10%) Query: 6 IRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPKG 65 +++ ++ GK V++RVD NV VK G ++D RI A PT+ +G + IL++H+GRPK Sbjct: 13 LQNAEMDGKVVLLRVDHNV-VKAGEIKDPYRIDATFPTLYAIAARGGRPILITHVGRPKD 71 Query: 66 EPSPEF------SLAPVAKRLSELLGKEVKFVPAVVGDE----------VKKAVEELKEG 109 + S E ++ +AK L + L + + E V AVE+LK G Sbjct: 72 KKSGEIVCRQGEAVDAIAKYLEQKLAVRIHVPEFPIDPERGILHLDRERVAPAVEDLKHG 131 Query: 110 --EVLLLENTRFHPGETKNDPELAKF---WASLADIHVNDAFGTAHRAHASNVGIAQFIP 164 +++ L N+R+ GE E F AS+AD++VNDAFG+ R HAS IA +P Sbjct: 132 RFDMIYLPNSRWFAGEQAKGKERESFAQEMASIADLYVNDAFGS-WRPHASTFDIAAKLP 190 Query: 165 SVAGFLMEKEIKFLSKVTYNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFT 224 S AG L+++EI L + PEKP+V V+ GAK KIG I L +K D +++GG + T Sbjct: 191 SFAGILLQREISNLHRAL-EPEKPFVAVVAGAKYDTKIGPIKALYDKVDHLILGGLIYNT 249 Query: 225 FLKA-LGKEVGSSRVEEDKIDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVE-KKVVR 282 FL A G + V ++ I LA+EL+E +G + +P + E G E + V Sbjct: 250 FLAAKYGARIAG--VADEDIALARELVEMDSGQGRIVEMPFLVEVDTMDEKGREGARKVS 307 Query: 283 IDDGIPEGWMG--LDIGPETIELFK--QKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALA 338 + D + G G +D+ P+++ + Q + A TV N MG + + EGT+ + Sbjct: 308 MADMVKGGTFGYIVDVHPDSLMHSETVQVIDSAMTVFVNAVMGYMPL--YPEGTRALYEL 365 Query: 339 IAALTEKGAITVVGGGDSAAAVNKF-------GLEDKFSHVSTGGGASLEFLE 384 I K + + GGD+ + GL D ++ TGGG L +E Sbjct: 366 IG--RNKRSQKLFAGGDTLQELRSLCPGVYLSGLNDPDTYYFTGGGTVLTAIE 416 Score = 25.4 bits (54), Expect = 0.006 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Query: 344 EKGAITVVGGGDSAAAVNKF-GLEDKFSHVSTGGGASLEFLEGKELPGIASIADKK-KIT 401 EK + VV G + L DK H+ GG FL K IA +AD+ + Sbjct: 211 EKPFVAVVAGAKYDTKIGPIKALYDKVDHLILGGLIYNTFLAAKYGARIAGVADEDIALA 270 Query: 402 RKLI 405 R+L+ Sbjct: 271 RELV 274 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 621 Number of extensions: 31 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 654 Length of database: 432 Length adjustment: 35 Effective length of query: 619 Effective length of database: 397 Effective search space: 245743 Effective search space used: 245743 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory