Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_028322970.1 H567_RS0121575 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000422285.1:WP_028322970.1 Length = 381 Score = 209 bits (532), Expect = 1e-58 Identities = 123/379 (32%), Positives = 202/379 (53%), Gaps = 9/379 (2%) Query: 11 VPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGI 70 +PPF VMD+ A + ++ D+V+L G+P P + AA A+ + Y+ +LG+ Sbjct: 11 IPPFIVMDILEKAQQMEKAGRDVVHLEIGEPDFTTPPCICNAAVKAIARGETHYTHSLGL 70 Query: 71 PELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRN 130 LR+AI + + +G++V P+ +++T+G+S + F A + GD + ++ P YPCY N Sbjct: 71 LALREAICRHHLQAYGVSVTPEQILVTSGTSPALFMIFAALLEPGDEIILSDPHYPCYPN 130 Query: 131 ILSALGCEVVEIPCGPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIA 189 +G E V + C + FQ A + + + R V++ SPANPTG ++ + + IA Sbjct: 131 FARFIGAEPVFVRCSEEDGFQLRADAIQKAVTRRTRAVLINSPANPTGNLLDSDRMKEIA 190 Query: 190 SWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVP 249 + ++SDE+YHGLVY G P S + +RNA V+N FSK YAMTGWRLG+++ P Sbjct: 191 ----GLGLPIVSDEIYHGLVY-GHPAHSIL-EFTRNAFVLNGFSKRYAMTGWRLGYIIAP 244 Query: 250 TVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIG 309 R + + N I +SQ A V+A EA A+ + Y R ++D ++++G Sbjct: 245 PEFIRPLQKVQQNLFISAGSISQWAGVAAL-EEAAADVQRMVEIYDERRRYMIDRIQKMG 303 Query: 310 IDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAG 369 GAFY+ + S ++L GV + PGIDF A ++R S+A Sbjct: 304 FRLPVEPAGAFYLLVNARHLEEKSYDLAFEILEKAGVGVTPGIDFG-ANVEGYLRFSYAN 362 Query: 370 PSGDIEEALRRIGSWLPSQ 388 I+E L R+ ++ ++ Sbjct: 363 HLDRIKEGLDRLERFIETR 381 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 381 Length adjustment: 30 Effective length of query: 358 Effective length of database: 351 Effective search space: 125658 Effective search space used: 125658 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory