Align candidate WP_081662709.1 G579_RS18665 (hypothetical protein)
to HMM PF02965 (Met_synt_B12)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF02965.21.hmm # target sequence database: /tmp/gapView.21265.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: Met_synt_B12 [M=273] Accession: PF02965.21 Description: Vitamin B12 dependent methionine synthase, activation domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-49 152.3 0.0 1.1e-48 152.1 0.0 1.0 1 lcl|NCBI__GCF_000423825.1:WP_081662709.1 G579_RS18665 hypothetical protei Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000423825.1:WP_081662709.1 G579_RS18665 hypothetical protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 152.1 0.0 1.1e-48 1.1e-48 2 257 .. 42 289 .] 41 289 .] 0.93 Alignments for each domain: == domain 1 score: 152.1 bits; conditional E-value: 1.1e-48 Met_synt_B12 2 leelveyidWtpffqa.WelkgkypkiledekvgeeakklfkdAqamLkkiieekllkakavvglfpAn 69 l+ +v+yi+ + +++ W++k p++ +e ++ + +++ +++++ ++++ l+ kav+g fpA+ lcl|NCBI__GCF_000423825.1:WP_081662709.1 42 LRAIVPYINRNTLYKFqWGFK--APEMSPQEYKAWARTEVDPIFNRLVAASEAQSILQPKAVYGYFPAQ 108 788999**9998886337775..57888888888888888888999*********************** PP Met_synt_B12 70 segddievyadesrseelatlhtLrqqaekeegkpnlclaDfvapkesgvkDyiGlFavtaglgieela 138 segdd++vy+d ++++e a++++ rq++++ +c+aDf +p +sg+ D++++ vt+g+++ ++a lcl|NCBI__GCF_000423825.1:WP_081662709.1 109 SEGDDLIVYTDPESRQERARFTFPRQKTAR-----RRCIADFFRPVDSGEMDVVAFQLVTVGQHAADHA 172 *************999**********9776.....69******************************** PP Met_synt_B12 139 kefeaekddYsail.vkaladrLaeAfaellhekvrkelWgyakdeklsneelikekYqgiRpApGYpa 206 +e+ + d+Y++ l + l ae +ae++h+++r e g+a++++ +++++ik++Y+g R+++GYpa lcl|NCBI__GCF_000423825.1:WP_081662709.1 173 RELFHG-DQYQEYLyWHGLNAEGAEGLAEYIHKQIRAE-LGFAREDARDIQAMIKQEYRGSRYSFGYPA 239 *99877.99998662688*******************9.6***************************** PP Met_synt_B12 207 cpdhtekktlfelldaeekigieLteslamtPaasvsGlyfahpearyFav 257 cp+ + ++++ +ll ae+ ig+ + ++ ++P+ s s+++ hp+a+yF+v lcl|NCBI__GCF_000423825.1:WP_081662709.1 240 CPNLHDQHKILDLLGAER-IGVVMGDEDQLWPEDSTSAIVAHHPQAKYFGV 289 *****************9.******************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (273 nodes) Target sequences: 1 (289 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.82 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory