GapMind for Amino acid biosynthesis

 

Alignments for a candidate for B12-reactivation-domain in Thermithiobacillus tepidarius DSM 3134

Align candidate WP_081662709.1 G579_RS18665 (hypothetical protein)
to HMM PF02965 (Met_synt_B12)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/PF02965.21.hmm
# target sequence database:        /tmp/gapView.21265.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       Met_synt_B12  [M=273]
Accession:   PF02965.21
Description: Vitamin B12 dependent methionine synthase, activation domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    9.7e-49  152.3   0.0    1.1e-48  152.1   0.0    1.0  1  lcl|NCBI__GCF_000423825.1:WP_081662709.1  G579_RS18665 hypothetical protei


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000423825.1:WP_081662709.1  G579_RS18665 hypothetical protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  152.1   0.0   1.1e-48   1.1e-48       2     257 ..      42     289 .]      41     289 .] 0.93

  Alignments for each domain:
  == domain 1  score: 152.1 bits;  conditional E-value: 1.1e-48
                              Met_synt_B12   2 leelveyidWtpffqa.WelkgkypkiledekvgeeakklfkdAqamLkkiieekllkakavvglfpAn 69 
                                               l+ +v+yi+ +  +++ W++k   p++  +e ++ + +++    +++++  ++++ l+ kav+g fpA+
  lcl|NCBI__GCF_000423825.1:WP_081662709.1  42 LRAIVPYINRNTLYKFqWGFK--APEMSPQEYKAWARTEVDPIFNRLVAASEAQSILQPKAVYGYFPAQ 108
                                               788999**9998886337775..57888888888888888888999*********************** PP

                              Met_synt_B12  70 segddievyadesrseelatlhtLrqqaekeegkpnlclaDfvapkesgvkDyiGlFavtaglgieela 138
                                               segdd++vy+d ++++e a++++ rq++++      +c+aDf +p +sg+ D++++  vt+g+++ ++a
  lcl|NCBI__GCF_000423825.1:WP_081662709.1 109 SEGDDLIVYTDPESRQERARFTFPRQKTAR-----RRCIADFFRPVDSGEMDVVAFQLVTVGQHAADHA 172
                                               *************999**********9776.....69******************************** PP

                              Met_synt_B12 139 kefeaekddYsail.vkaladrLaeAfaellhekvrkelWgyakdeklsneelikekYqgiRpApGYpa 206
                                               +e+ +  d+Y++ l  + l    ae +ae++h+++r e  g+a++++ +++++ik++Y+g R+++GYpa
  lcl|NCBI__GCF_000423825.1:WP_081662709.1 173 RELFHG-DQYQEYLyWHGLNAEGAEGLAEYIHKQIRAE-LGFAREDARDIQAMIKQEYRGSRYSFGYPA 239
                                               *99877.99998662688*******************9.6***************************** PP

                              Met_synt_B12 207 cpdhtekktlfelldaeekigieLteslamtPaasvsGlyfahpearyFav 257
                                               cp+ + ++++ +ll ae+ ig+ + ++  ++P+ s s+++  hp+a+yF+v
  lcl|NCBI__GCF_000423825.1:WP_081662709.1 240 CPNLHDQHKILDLLGAER-IGVVMGDEDQLWPEDSTSAIVAHHPQAKYFGV 289
                                               *****************9.******************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (273 nodes)
Target sequences:                          1  (289 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 8.82
//
[ok]

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory