Align Ketol-acid reductoisomerase (NAD(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.382 (characterized)
to candidate WP_027723029.1 H589_RS0116415 ketol-acid reductoisomerase
Query= SwissProt::K4LVZ1 (332 letters) >NCBI__GCF_000425265.1:WP_027723029.1 Length = 331 Score = 257 bits (656), Expect = 3e-73 Identities = 143/319 (44%), Positives = 194/319 (60%), Gaps = 7/319 (2%) Query: 2 KIYYDQDADLQYLDGKTVAVIGYGSQGHAQSQNLRDSGVKVVVA--DIPSSENWKKAEEA 59 KIY D+D D+ LDGKTVAVIGYGSQG AQS N+R+SGVKV+V D +W KAE Sbjct: 8 KIYRDEDVDMSVLDGKTVAVIGYGSQGRAQSMNMRESGVKVIVGAGDRTRHSSWDKAEAD 67 Query: 60 QFQPLTADEAAREADIIQILVPDEKQAALYRESIAPNLRPGKALVFSHGFNIHFKQIVPP 119 F+ + ++A +ADI+ IL+ D Q +Y ESI NLRPG+ L F+HGF I + I PP Sbjct: 68 GFEVFSIEKAVEKADIVHILLQDPAQPPVYYESIHANLRPGQTLSFAHGFAILYGTIRPP 127 Query: 120 PDVDVFMVAPKGPGHLVRRMYEEGAGVPSLVAVEQDYSGQALNLALAYAKGIGATRAGVI 179 D+DV + P GPG + R+ Y++G+G+ V+V+QD SG A ALA AK +G+TR G + Sbjct: 128 KDIDVVLFVPNGPGPVTRQKYKDGSGIWGCVSVDQDVSGHAQETALAIAKAVGSTRVGAV 187 Query: 180 QTTFKEETETDLFGEQAVLCGGITELIRAGFDTLVDAGYQPEIAYFECLHEMKLIVDLIY 239 TF+ ETE D + EQ VL GG L+R ++ +V GY AY + + ++ I+D I Sbjct: 188 AMTFQHETEGDNYEEQ-VLYGGTIHLMRTMYNIMVKNGYPRSFAYAKAIRSIRSIIDDID 246 Query: 240 EGGI-STMRYSISDTAEYGDLTRGKRIITEATREEMKKILKEIQDGVFAREWLLENQVGR 298 E GI S + S T E+ G R+I E EEM+KI +E + G FA+ WL E +G Sbjct: 247 EVGIESYLTSRASRTCEFAVRHSGPRVINE---EEMEKIFEETESGTFAKNWLQEFSLGM 303 Query: 299 PVYNALRRKEQNHLIETVG 317 P N +RR +E G Sbjct: 304 PTLNRIRRTWAESDMEQTG 322 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 331 Length adjustment: 28 Effective length of query: 304 Effective length of database: 303 Effective search space: 92112 Effective search space used: 92112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_027723029.1 H589_RS0116415 (ketol-acid reductoisomerase)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00465.hmm # target sequence database: /tmp/gapView.15110.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00465 [M=314] Accession: TIGR00465 Description: ilvC: ketol-acid reductoisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-92 295.1 0.0 3e-92 294.9 0.0 1.0 1 lcl|NCBI__GCF_000425265.1:WP_027723029.1 H589_RS0116415 ketol-acid reduct Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000425265.1:WP_027723029.1 H589_RS0116415 ketol-acid reductoisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 294.9 0.0 3e-92 3e-92 1 309 [. 20 328 .. 20 331 .] 0.95 Alignments for each domain: == domain 1 score: 294.9 bits; conditional E-value: 3e-92 TIGR00465 1 lkgkkvaiiGyGsqGeaqalnlrdsglnvivglrkea..aswkkAeedGfkvltveeaikkadlimiLl 67 l+gk+va+iGyGsqG+aq++n+r+sg++vivg + +sw+kAe dGf+v+++e a++kad+++iLl lcl|NCBI__GCF_000425265.1:WP_027723029.1 20 LDGKTVAVIGYGSQGRAQSMNMRESGVKVIVGAGDRTrhSSWDKAEADGFEVFSIEKAVEKADIVHILL 88 689****************************98655555****************************** PP TIGR00465 68 pDevqkevyeaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsl 136 D +q+ vy ++i+ +l+ g++l+f+HGf i + +i++pkd+dvvl P gpG + R++yk g G+ + lcl|NCBI__GCF_000425265.1:WP_027723029.1 89 QDPAQPPVYYESIHANLRPGQTLSFAHGFAILYGTIRPPKDIDVVLFVPNGPGPVTRQKYKDGSGIWGC 157 ********************************************************************* PP TIGR00465 137 iAveqdvtgeakeiAlayAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGy 205 + v qdv+g+a+e+Ala+Aka+G++r+g + tF++E+e D + Eq vL Gg l+++ ++ +v++Gy lcl|NCBI__GCF_000425265.1:WP_027723029.1 158 VSVDQDVSGHAQETALAIAKAVGSTRVGAVAMTFQHETEGDNYEEQ-VLYGGTIHLMRTMYNIMVKNGY 225 *******************************************998.57788888999*********** PP TIGR00465 206 qpelAyfeivhelklivdllkekGle.lmrdavsntAklgalelr.eilkeelkkemqkilkeiqnGef 272 + Ay + + +++i+d + e G+e ++ ++ s t ++ +++ ++++e +em+ki++e+++G+f lcl|NCBI__GCF_000425265.1:WP_027723029.1 226 PRSFAYAKAIRSIRSIIDDIDEVGIEsYLTSRASRTCEFAVRHSGpRVINE---EEMEKIFEETESGTF 291 *************************8468999*******999999777776...69************* PP TIGR00465 273 akewalekeagkpafeearkkekeqeiekvGkelral 309 ak+w+ e++ g p+++++r++ e ++e++Gk r+ lcl|NCBI__GCF_000425265.1:WP_027723029.1 292 AKNWLQEFSLGMPTLNRIRRTWAESDMEQTGKIWREK 328 ********************************99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (314 nodes) Target sequences: 1 (331 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 9.40 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory