Align branched-chain amino acid aminotransferase 2; EC 2.6.1.42 (characterized)
to candidate WP_027722021.1 H589_RS0110805 D-amino-acid transaminase
Query= CharProtDB::CH_012531 (298 letters) >NCBI__GCF_000425265.1:WP_027722021.1 Length = 281 Score = 147 bits (370), Expect = 4e-40 Identities = 96/284 (33%), Positives = 148/284 (52%), Gaps = 17/284 (5%) Query: 6 IFLNGEFVPKDEAKVSVYDHGYLYGDGVFEGIRVYSGNVFRLREHLVRLYESAKSIMLEI 65 ++LNG +VP++EA VSV+D G+L+ DG++E V G + H+ RL S + + + Sbjct: 5 VYLNGAYVPEEEAMVSVFDRGFLFADGIYEVTAVLDGKICEFEGHVKRLERSLGVLDMPM 64 Query: 66 PYSLDEITNIVVETIRQNKLSNGYIRLVVSRGAGNLGLDPDSCTKPNVVVIAEQLSLFPQ 125 P DE+ I E +++N L G I L V+RGA + K +V+ + +L Sbjct: 65 PVDKDELLEIHRELVKRNNLDQGAIYLQVTRGAADRDFVYPKNVKQTLVLFTQAKTLTDD 124 Query: 126 EYYEKGIPVVTVATRRNRPDVL--SPQVKSLNYLNNILVRIEAKLAGVQEALMLNDQGYV 183 + GI V+ PD+ VK++ L + ++ AK AG +A M+ D G+V Sbjct: 125 ---KAGIKVIAA------PDIRWGRRDVKTVQLLAPSMCKMMAKAAGKDDAWMVED-GFV 174 Query: 184 AEGSGDNVFIV-KGNKLITPPSSAGALEGITRNAILEIGEKLGYDVREELFTRHDVYVAD 242 EGS +N +IV K K++T S L GITR+++L I ++ ++ E FT + A Sbjct: 175 TEGSSNNAYIVTKEGKIVTRNLSNSILHGITRSSVLRIAAEMDMEIEERAFTIAEAQDAA 234 Query: 243 EVFLTGTAAEVIAVTTVDGRTIGLGQTGPHTNRL----LEEFRK 282 E F+T V V +DG TIG G+ GP RL +EE RK Sbjct: 235 EAFITAATTFVCPVLEIDGATIGDGKPGPVATRLNTVYIEEARK 278 Lambda K H 0.317 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 281 Length adjustment: 26 Effective length of query: 272 Effective length of database: 255 Effective search space: 69360 Effective search space used: 69360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory