Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_027722237.1 H589_RS0111985 aminotransferase
Query= BRENDA::E6TUA8 (302 letters) >NCBI__GCF_000425265.1:WP_027722237.1 Length = 314 Score = 147 bits (370), Expect = 4e-40 Identities = 81/253 (32%), Positives = 137/253 (54%), Gaps = 3/253 (1%) Query: 24 DHGFLYGDGVFEGIRVYDGNIFKLTEHLKRLYESAQSIMLEIPYSKEDFQQIIVDTVRKN 83 DH GDGVFE I+ +G +++L H++R+ SA+SI LE P S + II++ + Sbjct: 49 DHLVHRGDGVFESIKFLNGKMYQLDPHIRRMKRSARSIYLEPPCSWAELSDIILEVAAGS 108 Query: 84 QLESGYIRVVVSRGPGNLGLDPSRCSAPHVIVIAEELALFPKELYELGLTVASVASRRNR 143 +ESG +RV++ RG G G+DPS C P + ++ + P+ YE GLT + + Sbjct: 109 GVESGMVRVLLGRGGGGFGIDPSECPVPSLYIVIYKYEPKPESWYEKGLTAFKTSIPAKQ 168 Query: 144 PDVLSPQIKSLNYLNNILVKLEANQAGAHEALMLNDQGYVTEGSADNIFIVKNNTIITPP 203 P + + IKS++YL N+L+K EA + G + ++ ++ EG+ +N+ IV + + P Sbjct: 169 PYLAT--IKSIDYLPNVLMKREATEKGFNIPFCFDNLNFLAEGATENVCIVNSEGTLHVP 226 Query: 204 VYLGALEGITRNAIIDLAKECGYEMKETPFTRHDVYVADEVFLTGTAAEVIAVVEVDKRM 263 + AL G T L + E+ + D+ +A EV + GT+ + + VV +K+ Sbjct: 227 QFTNALAGTTLTRATQLIAD-EVEIDYRAISEDDILLAKEVIVCGTSIDAVGVVRYNKKP 285 Query: 264 ISDGKPGKVTNHL 276 I D +PG V + Sbjct: 286 IHDVRPGPVCKRM 298 Lambda K H 0.318 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 314 Length adjustment: 27 Effective length of query: 275 Effective length of database: 287 Effective search space: 78925 Effective search space used: 78925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory