Align Acetolactate synthase large subunit; AHAS; EC 2.2.1.6; Acetohydroxy-acid synthase large subunit; ALS (uncharacterized)
to candidate WP_026607721.1 METAC_RS0115265 thiamine pyrophosphate-binding protein
Query= curated2:Q7U5G1 (617 letters) >NCBI__GCF_000427445.1:WP_026607721.1 Length = 574 Score = 222 bits (566), Expect = 3e-62 Identities = 174/556 (31%), Positives = 258/556 (46%), Gaps = 29/556 (5%) Query: 23 GAAALMDALRRHGVDTIFGYPGGAILPIYDALHIAESEGWVKHILVRHEQAGTHAADAYA 82 G ++DAL GVD +F PGG + P AL ++ +K I+ E + AD YA Sbjct: 4 GTDFILDALASEGVDHLFMVPGGLVDPFLPALGRQKA---LKPIVAAQEGGAVYMADGYA 60 Query: 83 RATGKVGVCFGTSGPGATNLVTGIATAQMDSVPMVVITGQVPRPAIGTDAFQET-----D 137 RA+GK G GPG TN VT +A AQ D P+++++G+V G FQ+ D Sbjct: 61 RASGKFGAALCIGGPGFTNTVTAVAAAQTDGSPVLLLSGEVATLVEGLGMFQDASPLTLD 120 Query: 138 IFGITLPIVKHSWVVRDPADLGSIVAQAFLIAASGRPGPVLIDIPKD--VGQEQFNYVPV 195 + PIV+ S V +P +L I A L + GPV + +P D + + +YVP+ Sbjct: 121 DVSVLKPIVRMSSSVDNPKNLPHIFKHAMLQLRTKPSGPVHLSLPSDCQIAELSVDYVPI 180 Query: 196 EPGSVIPGGFHQPEPPLDAAVAAALDLIEQAQRPLLYVGGGAISACAHDSLRMLAERYQL 255 +P V P D R + G G A A +LR AE +++ Sbjct: 181 DPTLVDPAPLSLSGAEAAFRHFTGADGGRPPIRIAILAGAGVEHAYAAKALRQFAELWRI 240 Query: 256 PVTTTLMGKGAFDENDALSVGMLGMHGTAYANFAVTEC--DLLIAVGARFDDRVTGKLDT 313 PV TTL KG F E+ LS+G+ G GT +A A+ + DLLI + + ++R T Sbjct: 241 PVATTLRAKGVFPEDHVLSLGVFGYGGTHHARMALLDAPPDLLIVLASGLNERDTMHWSL 300 Query: 314 FAPRARVVHFEIDPAEIGKNRKADVAVLGDLG------LSLARMVEISLQRTAEPRTAAW 367 + + + A IG + A V+GD G L +++ SL T+ AW Sbjct: 301 QLAPSATICVNLAAANIGMH-SAGGGVVGDCGAFLRYLLDRTDVLDASLG-TSRAAREAW 358 Query: 368 LERINTWKDRYPLTIPPAEGA-IYPQEVLLAVRDLAP-DAIVTTDVGQHQMWAAQHLRN- 424 L I + ++ I+P ++ +R P D ++ D G H+ +A + + Sbjct: 359 LSEIRATPRLQDVEHCASDAVPIHPARIIAELRRAFPRDGVLLVDSGAHRAFAGHYWESY 418 Query: 425 GPRGWISSAGLGTMGFGMPAAMGAQVAMPDRQVVCIAGDASILMNIQELGTLAAYGLPVK 484 PR +IS+ LG MG+ +PAA G Q A P R+V + GD + MN E+ T A YGLP+ Sbjct: 419 EPRTYISATNLGPMGWAIPAAAGVQCAQPQRRVAVVTGDGCMGMNGIEVATAARYGLPIL 478 Query: 485 VVIVNNHWQGMVRQWQESFYDERYSASDMLNGMP--DFIALARSFGVDGVKITDRELLHR 542 V+VNN G V W + + D L +P D+ ARS G G + + L Sbjct: 479 FVVVNNAALGNV--WLRA--HKLGPVPDELTRLPDHDWAGFARSLGCRGETVREPGDLAG 534 Query: 543 DLAAALQSPTPTMIDV 558 A L P +IDV Sbjct: 535 AFARGLAGEGPCLIDV 550 Lambda K H 0.320 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 953 Number of extensions: 66 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 617 Length of database: 574 Length adjustment: 37 Effective length of query: 580 Effective length of database: 537 Effective search space: 311460 Effective search space used: 311460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory