Align branched-chain amino acid aminotransferase subunit (EC 2.6.1.6; EC 2.6.1.42) (characterized)
to candidate WP_028316504.1 G491_RS0125150 hypothetical protein
Query= metacyc::MONOMER-11904 (286 letters) >NCBI__GCF_000429905.1:WP_028316504.1 Length = 288 Score = 92.4 bits (228), Expect = 1e-23 Identities = 82/259 (31%), Positives = 123/259 (47%), Gaps = 11/259 (4%) Query: 3 IYLNGEFVEKEQAKISVYDHGLLYGDGVFEGIRVYDGVIFKLKEHIDRLFDSATSLQMDI 62 I+LNG F+ + QA+IS D GLL+GDG+FE IR +G L++H++R+ SA + Sbjct: 16 IWLNGAFLPESQARISPLDRGLLFGDGLFETIRAQNGEPMFLEDHLERIKASARRFNLPW 75 Query: 63 QTSKDEISKIVIDTIRINELNN--AYIRLVITRGVGDLGLDPRKCPKPTIFCIAEPMNPL 120 D I+I IR N L + A +++V+TRG GL PT +AE N L Sbjct: 76 NGGLD-WDGILIGLIRKNNLQDGLARLKIVLTRGCAP-GLGLPHASNPTCMALAE--NYL 131 Query: 121 LGEDGIKVITSSIRRLPVDVLNPAV---KSLNYLNSILAKIQANYAGCDEAFLLDSEGYV 177 G + +P ++P + K+LNYL + K +A GC EA +LD +G V Sbjct: 132 APASGAYAQGWDL-YIPEQSISPPLSGHKTLNYLYYMAMKQEAIDNGCHEALILDKDGMV 190 Query: 178 AEGTGDNIFVIKNGKIKTPPVSSSVLKGITRDAVVDLAKEQGYEIIEEKLTLHDLYVADE 237 AE N+ T P + L G V L K QG+ I + + + L A Sbjct: 191 AETCTANLLAYDINGWYT-PATHWRLPGTAFKQVERLLKRQGHIIRRQPVMVRQLANAQW 249 Query: 238 LFITGTAAELAHVVEIDGR 256 ++ + + V I G+ Sbjct: 250 VWALNSLMGIMPVHSIGGQ 268 Lambda K H 0.319 0.140 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 288 Length adjustment: 26 Effective length of query: 260 Effective length of database: 262 Effective search space: 68120 Effective search space used: 68120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory