Align Chorismate synthase ARO2; 5-enolpyruvylshikimate-3-phosphate phospholyase; Aromatic amino acid requiring protein 2; EC 1.5.1.38; EC 4.2.3.5 (characterized)
to candidate WP_028585259.1 G494_RS0115545 chorismate synthase
Query= SwissProt::P28777 (376 letters) >NCBI__GCF_000429965.1:WP_028585259.1 Length = 361 Score = 443 bits (1139), Expect = e-129 Identities = 231/367 (62%), Positives = 277/367 (75%), Gaps = 11/367 (2%) Query: 2 STFGKLFRVTTYGESHCKSVGCIVDGVPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEKD 61 ST G L++V+T+GESHCK VG IVDG PPGM L+EADIQPQL+RRRPGQS L+TPR E D Sbjct: 3 STLGTLYKVSTFGESHCKGVGAIVDGCPPGMELSEADIQPQLSRRRPGQSDLTTPRQEAD 62 Query: 62 RVEIQSGTEFGKTLGTPIAMMIKNEDQRPHDYSDMDKFPRPSHADFTYSEKYGIKASSGG 121 +V I SGTEFG+TLGTPI ++I N+DQRP DY +M PRPSHADFTY KYGI+ASSGG Sbjct: 63 QVTIYSGTEFGRTLGTPIMLLIHNKDQRPGDYGEMSTIPRPSHADFTYQLKYGIRASSGG 122 Query: 122 GRASARETIGRVASGAIAEKFLAQNSNVEIVAFVTQIGEIKMNRDSFDPEFQHLLNTITR 181 GR+SARETIGRVA+GAIAEK+L QN EIVA+V+ +G+I+ + DP I+R Sbjct: 123 GRSSARETIGRVAAGAIAEKWLQQNYGTEIVAWVSSVGDIE--APAIDP------GRISR 174 Query: 182 EKVDSMGPIRCPDASVAGLMVKEIEKYRGNKDSIGGVVTCVVRNLPTGLGEPCFDKLEAM 241 ++VDS IRCP A LM + + + KDS GG++TCV RNLP GLGEP FDKL+A Sbjct: 175 QEVDST-LIRCPHGPTAELMEQRVAEILEAKDSTGGILTCVCRNLPVGLGEPIFDKLDAC 233 Query: 242 LAHAMLSIPASKGFEIGSGFQGVSVPGSKHNDPFYFEKETNRLRTKTNNSGGVQGGISNG 301 LA AMLS+PA+KGF+IGSGF G + GS+HNDPF ++ L T +NNSGGVQGGISNG Sbjct: 234 LAQAMLSLPATKGFDIGSGFAGTRMRGSEHNDPFV--RKGAGLGTSSNNSGGVQGGISNG 291 Query: 302 ENIYFSVPFKSVATISQEQKTATYDGEEGILAAKGRHDPAVTPRAIPIVEAMTALVLADA 361 E I F V FK VATI + Q+T +DG + LAAKGRHDP V PRAIPIVE+M ALVL D Sbjct: 292 EPIIFRVAFKPVATIGRVQQTVDFDGNQVELAAKGRHDPCVVPRAIPIVESMAALVLMDL 351 Query: 362 LLIQKAR 368 L Q+AR Sbjct: 352 ALQQRAR 358 Lambda K H 0.316 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 361 Length adjustment: 30 Effective length of query: 346 Effective length of database: 331 Effective search space: 114526 Effective search space used: 114526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_028585259.1 G494_RS0115545 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.23202.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-145 468.7 0.0 5.9e-145 468.5 0.0 1.0 1 lcl|NCBI__GCF_000429965.1:WP_028585259.1 G494_RS0115545 chorismate syntha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429965.1:WP_028585259.1 G494_RS0115545 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 468.5 0.0 5.9e-145 5.9e-145 2 350 .. 10 358 .. 9 359 .. 0.99 Alignments for each domain: == domain 1 score: 468.5 bits; conditional E-value: 5.9e-145 TIGR00033 2 rlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtGa 70 ++ tfGeSH+k +gai+dG+P+g+el+e+diq++l+rRrpgqs lt++r+E+D+v+i sG++ G+T G+ lcl|NCBI__GCF_000429965.1:WP_028585259.1 10 KVSTFGESHCKGVGAIVDGCPPGMELSEADIQPQLSRRRPGQSDLTTPRQEADQVTIYSGTEFGRTLGT 78 789****************************************************************** PP TIGR00033 71 PiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLket 139 Pi lli+Nkd+r+ dy +++++pRP+Had+ty+ KYgi++++gggrsSaReT++rvaaGa+a+k+L+++ lcl|NCBI__GCF_000429965.1:WP_028585259.1 79 PIMLLIHNKDQRPGDYGEMSTIPRPSHADFTYQLKYGIRASSGGGRSSARETIGRVAAGAIAEKWLQQN 147 ********************************************************************* PP TIGR00033 140 agieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvvs 208 +g+eiva+v+++g++e++ +is++++d++ +rcp +++ me+ + ++ +++ds Gg++++v + lcl|NCBI__GCF_000429965.1:WP_028585259.1 148 YGTEIVAWVSSVGDIEAPAIDPGRISRQEVDSTLIRCPHGPTAELMEQRVAEILEAKDSTGGILTCVCR 216 *******************9999********************************************** PP TIGR00033 209 nvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGie 277 n+pvglGep+fdklda la+a+ls++A Kg++iG+GF+ +++rGse+nD++v + ++ + +nnsGG++ lcl|NCBI__GCF_000429965.1:WP_028585259.1 217 NLPVGLGEPIFDKLDACLAQAMLSLPATKGFDIGSGFAGTRMRGSEHNDPFVRKGAGLGTSSNNSGGVQ 285 ********************************************************************* PP TIGR00033 278 GGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladalle 346 GGi+nGe+i +r+a+Kp++ti++ ++tvd ++++ a+kgRhDpcvvpra+p+vE+m alvl+d++l+ lcl|NCBI__GCF_000429965.1:WP_028585259.1 286 GGISNGEPIIFRVAFKPVATIGRVQQTVDFDGNQVELAAKGRHDPCVVPRAIPIVESMAALVLMDLALQ 354 ********************************************************************* PP TIGR00033 347 kras 350 +ra+ lcl|NCBI__GCF_000429965.1:WP_028585259.1 355 QRAR 358 9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (361 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.58 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory