Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_028585906.1 G494_RS0119800 branched-chain amino acid aminotransferase
Query= BRENDA::A0A2Z4MEX9 (357 letters) >NCBI__GCF_000429965.1:WP_028585906.1 Length = 361 Score = 404 bits (1039), Expect = e-117 Identities = 197/345 (57%), Positives = 247/345 (71%) Query: 11 EQKKEKPASDKLGFGVHFTDHMFTMDYTEGKGWHDPQIVPYSPLTLDPAAMVFHYGQAVF 70 +Q K KPA DKLGFG F+DHMF+M + +GWH I PY L LDPAAMV HYGQA+F Sbjct: 16 DQLKSKPAQDKLGFGQFFSDHMFSMKWNRKQGWHQAAIQPYRQLDLDPAAMVLHYGQAIF 75 Query: 71 EGLKAYRNQEGKVRLFRPDQNFKRMNRSLERMSMPLIDEEFMVEALKQLVAVDKEWIPTE 130 EG+KAYR ++G++ LFRP NF RMN S RM MP EE +++AL+ L+ +D+EW+P Sbjct: 76 EGMKAYRAEDGRILLFRPQDNFARMNLSAVRMCMPRFPEERVLQALRSLIYLDREWVPRS 135 Query: 131 SGQSLYIRPFVIATEPCFGVRASHTYKLVIVLSPVGAYYAGGMKPVKIYVENNYVRAVRG 190 G SLYIRP +IATEP G+RA+ Y+ I+ PVGAYYA G P IYVE+ YVRAV G Sbjct: 136 EGASLYIRPTMIATEPMLGLRAAEEYQFFIIACPVGAYYAEGFNPTTIYVEDQYVRAVPG 195 Query: 191 GTGNAKVAGNYAGSLKAQVEAKEKGYEQVLWLDGVENKYIEEVGSMNVFFKVKGEVWTPA 250 G G+AK AGNYA SLKAQ+ A++KGY QVLWLD E+KYIEEVG+ N+FF + + TP Sbjct: 196 GVGDAKTAGNYAASLKAQIAAQKKGYTQVLWLDAREHKYIEEVGTSNIFFMINDVLLTPP 255 Query: 251 LNGSILEGITRDSTIQLLKDWGIPVVEKRISMEDLHTAYVNGELEEAFGTGTAAVISPVG 310 L GSIL GITRDS +QL +DW I V E+ IS++++ TA NG L+E+FGTGTAAVI+PVG Sbjct: 256 LEGSILPGITRDSVLQLARDWEIRVEERPISIDEIITASENGTLQESFGTGTAAVIAPVG 315 Query: 311 DLNWNGHQMIINGEKTGELTTRLYDEMTGIQYGDREDKFGWSVEV 355 +L + + IN TG L RLY+E+ GIQ+G R D W V V Sbjct: 316 ELCYKESSIQINQGTTGPLAKRLYEELQGIQFGSRADHHEWVVPV 360 Lambda K H 0.317 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 361 Length adjustment: 29 Effective length of query: 328 Effective length of database: 332 Effective search space: 108896 Effective search space used: 108896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_028585906.1 G494_RS0119800 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01123.hmm # target sequence database: /tmp/gapView.17653.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-130 418.5 0.0 8.1e-130 418.3 0.0 1.0 1 lcl|NCBI__GCF_000429965.1:WP_028585906.1 G494_RS0119800 branched-chain am Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429965.1:WP_028585906.1 G494_RS0119800 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 418.3 0.0 8.1e-130 8.1e-130 1 313 [] 48 360 .. 48 360 .. 0.99 Alignments for each domain: == domain 1 score: 418.3 bits; conditional E-value: 8.1e-130 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeel 69 W++a ++++ +l ld++++vlhYgq++feG+kayR +dG+illfRp++n +R++ sa r+ +P+ +ee lcl|NCBI__GCF_000429965.1:WP_028585906.1 48 WHQAAIQPYRQLDLDPAAMVLHYGQAIFEGMKAYRAEDGRILLFRPQDNFARMNLSAVRMCMPRFPEER 116 ********************************************************************* PP TIGR01123 70 flealkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsif 138 +l+al+ l+ +d++wvp + +asLY+RP++iate+ lG +aa+ey f+++a+PvGaY+++g +p++i+ lcl|NCBI__GCF_000429965.1:WP_028585906.1 117 VLQALRSLIYLDREWVPRSE-GASLYIRPTMIATEPMLGLRAAEEYQFFIIACPVGAYYAEGFNPTTIY 184 *****************888.************************************************ PP TIGR01123 139 veteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelv 207 ve++yvRa+p+G+G +k++GnYaasl+aq a+++g+ +v++ld+ e+k+ieevG++nif++++d l+ lcl|NCBI__GCF_000429965.1:WP_028585906.1 185 VEDQYVRAVPGGVGDAKTAGNYAASLKAQIAAQKKGYTQVLWLDAREHKYIEEVGTSNIFFMIND-VLL 252 *****************************************************************.9** PP TIGR01123 208 ttplsesiLegvtresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgelkieg 274 t+pl +siL+g+tr+s+l+la+d+ ++veer i+ide+ a+e+G + f++Gtaavi+Pvgel ++ lcl|NCBI__GCF_000429965.1:WP_028585906.1 253 TPPLEGSILPGITRDSVLQLARDWEIRVEERPISIDEIITASENGTLqeSFGTGTAAVIAPVGELCYKE 321 *********************************************99999******************* PP TIGR01123 275 kevevkseevGevtkklrdeltdiqyGkledkegWivev 313 ++++++++ +G+++k+l++el +iq+G+ +d+++W+v v lcl|NCBI__GCF_000429965.1:WP_028585906.1 322 SSIQINQGTTGPLAKRLYEELQGIQFGSRADHHEWVVPV 360 ************************************965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (361 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.62 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory