Align Fructose-bisphosphate aldolase class 1; EC 4.1.2.13; Fructose-bisphosphate aldolase class I; FBP aldolase (uncharacterized)
to candidate WP_027178900.1 G496_RS0108445 fructose-bisphosphate aldolase
Query= curated2:Q9V2I6 (281 letters) >NCBI__GCF_000429985.1:WP_027178900.1 Length = 253 Score = 106 bits (265), Expect = 4e-28 Identities = 79/262 (30%), Positives = 131/262 (50%), Gaps = 13/262 (4%) Query: 8 GIKRRLRRFFRRDG-RALIFAMDHGFEHGPTDFEPVWEHVNPRVIIRKVVRAGVDGVMML 66 G+ RRL R F + +LI A+DHG G P + I+R + R V GV++ Sbjct: 3 GVSRRLARLFDTESLNSLILALDHGANEGMI---PGLGGIPD--ILRAMPRHRVQGVILN 57 Query: 67 PGMARIAGDDVKPEVGLMIKITSKTNLRPKAEQLMQSQLAFVEDAIKLGADAIAATVYWG 126 G+A V E L+I++ + T R +S + +++A++LGADA++ V G Sbjct: 58 KGLANHYSKIVPVEANLIIQLNAGT--RHGTPTYNKSLVCSIQEALRLGADAVSIHVNIG 115 Query: 127 SPQEDAMMRQFAEIVSYAHDLGFPVVQFAYPRGPYIDEKYGRKEDYRVVMYGARAAAEMG 186 + ED M+ + E AH G PV+ + RG + ++ D +V + R AE+G Sbjct: 116 NEFEDRMLSEMGEATDEAHKYGLPVLATVFARGASVINEH----DPSLVAHCIRIGAELG 171 Query: 187 ADMIKTYWTGSRETFAKVVDAAAGVPVLLSGGAKAENPLDFLKVVYEVIEAGGSGAVVGR 246 D++ + + TF + V A+ +PVL++GG ++ L V + + AG G +GR Sbjct: 172 PDIVAVPYPHNGGTFNEAVKASP-IPVLVTGGPLGQDIEGTLANVSKGLAAGCRGCCIGR 230 Query: 247 NIFQRENPEPMIKALIRVIHRN 268 NIFQ E P + +V H++ Sbjct: 231 NIFQTEVPAESMAEFAKVTHKS 252 Lambda K H 0.321 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 253 Length adjustment: 25 Effective length of query: 256 Effective length of database: 228 Effective search space: 58368 Effective search space used: 58368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory