Align Fructose-bisphosphate aldolase; Glfba; glFBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 (characterized)
to candidate WP_027179546.1 G496_RS0112275 fructose-1,6-bisphosphate aldolase, class II
Query= SwissProt::A8B2U2 (323 letters) >NCBI__GCF_000429985.1:WP_027179546.1 Length = 307 Score = 298 bits (763), Expect = 1e-85 Identities = 161/310 (51%), Positives = 211/310 (68%), Gaps = 6/310 (1%) Query: 1 MPLCTLRQMLGEARKHKYGVGAFNVNNMEQIQGIMKAVVQLKSPVILQCSRGALKYSDMI 60 MPL + ++M A Y +GAFNVNNME IQGI++A + KSP+ILQ S GA KY+ Sbjct: 1 MPLVSPKEMFKGAYTGGYAIGAFNVNNMEIIQGIIEAGTEEKSPLILQVSAGARKYAGQG 60 Query: 61 YLKKLCEAALEKHPDIPICIHLDHGDTLESVKMAIDLGFSSVMIDASHHPFDENVRITKE 120 Y+ KL EAAL+ D+P+ +HLDHG E K ID GF+SVMID SH PFDEN+ +TK+ Sbjct: 61 YIIKLMEAALQD-TDLPVVLHLDHGQNFEICKKVIDAGFTSVMIDGSHLPFDENIAVTKK 119 Query: 121 VVAYAHARGVSVEAELGTLGGIEEDVQNTVQL-TEPQDAKKFVELTGVDALAVAIGTSHG 179 VV YAH +G+ VEAELG L G+E+DV + + T+P +A +FVE TG D+LA+AIGTSHG Sbjct: 120 VVEYAHPKGIWVEAELGRLAGVEDDVHSDEHIYTDPDEAVEFVEKTGCDSLAIAIGTSHG 179 Query: 180 AYKFKSESDIRLAIDRVKTISDL-TGIPLVMHGSSSVPKDVKDMINKYGGKMPDAVGVPI 238 AYKF + +L DR++ IS L P+V+HG+SSV ++ M N+YGG + A GVP Sbjct: 180 AYKFSGKP--KLDFDRLEKISSLMPDYPIVLHGASSVVQEYVQMANQYGGNIGGAKGVPE 237 Query: 239 ESIVHAIGEGVCKINVDSDSRMAMTGAIRKVFVEHPEKFDPRDYLGPGRDAITEMLIPKI 298 + + A VCKIN+D+D R+AMT IRK E+PE FDPR YLG R A+ +M+ KI Sbjct: 238 DLLRKAASMAVCKINIDTDIRLAMTAMIRKFLAENPEAFDPRGYLGEARKAVKDMVCHKI 297 Query: 299 K-AFGSAGHA 307 K GS+G A Sbjct: 298 KNVLGSSGKA 307 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 307 Length adjustment: 27 Effective length of query: 296 Effective length of database: 280 Effective search space: 82880 Effective search space used: 82880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_027179546.1 G496_RS0112275 (fructose-1,6-bisphosphate aldolase, class II)
to HMM TIGR01859 (fba: fructose-1,6-bisphosphate aldolase, class II (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01859.hmm # target sequence database: /tmp/gapView.29383.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01859 [M=282] Accession: TIGR01859 Description: fruc_bis_ald_: fructose-1,6-bisphosphate aldolase, class II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-117 378.4 0.4 3.9e-117 376.9 0.4 1.6 1 lcl|NCBI__GCF_000429985.1:WP_027179546.1 G496_RS0112275 fructose-1,6-bisp Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000429985.1:WP_027179546.1 G496_RS0112275 fructose-1,6-bisphosphate aldolase, class II # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 376.9 0.4 3.9e-117 3.9e-117 1 282 [] 3 307 .] 3 307 .] 0.98 Alignments for each domain: == domain 1 score: 376.9 bits; conditional E-value: 3.9e-117 TIGR01859 1 lvkakellekakkekYavgafninnlellqaileaaeeeksPvivqvsegavkYlggikvvvalvkali 69 lv+ ke+++ a++++Ya+gafn+nn+e++q i+ea+ eeksP+i+qvs ga+kY+g +++l++a++ lcl|NCBI__GCF_000429985.1:WP_027179546.1 3 LVSPKEMFKGAYTGGYAIGAFNVNNMEIIQGIIEAGTEEKSPLILQVSAGARKYAG-QGYIIKLMEAAL 70 7999***************************************************9.888999999999 PP TIGR01859 70 eklsivPvalhLDhGssyescikaikaGfssvmiDashlpleenlketkkvveiahakgvsveaelGkl 138 +++ +Pv+lhLDhG+++e c k i+aGf+svmiD+shlp++en++ tkkvve+ah kg+ veaelG+l lcl|NCBI__GCF_000429985.1:WP_027179546.1 71 QDTD-LPVVLHLDHGQNFEICKKVIDAGFTSVMIDGSHLPFDENIAVTKKVVEYAHPKGIWVEAELGRL 138 9888.**************************************************************** PP TIGR01859 139 gGieddvvekeaeladideakklvketgvDaLaiaiGtshG..kykgepkldferlkeikklln.lPlv 204 +G+eddv ++e ++d+dea ++v++tg D+LaiaiGtshG k+ g+pkldf+rl++i+ l++ P+v lcl|NCBI__GCF_000429985.1:WP_027179546.1 139 AGVEDDVHSDEHIYTDPDEAVEFVEKTGCDSLAIAIGTSHGayKFSGKPKLDFDRLEKISSLMPdYPIV 207 *****************************************8888899**************999**** PP TIGR01859 205 lhGas.....................Gipeeqlkkaiklgiakvnidtdlrlaftaairkvleekkdey 252 lhGas G+pe+ l+ka++++++k+nidtd+rla+ta irk+l+e+ + + lcl|NCBI__GCF_000429985.1:WP_027179546.1 208 LHGASsvvqeyvqmanqyggniggakGVPEDLLRKAASMAVCKINIDTDIRLAMTAMIRKFLAENPEAF 276 ********************************************************************* PP TIGR01859 253 dpRkilaparealkevvkekik.vlgsagka 282 dpR +l++ar+a+k++v +kik vlgs+gka lcl|NCBI__GCF_000429985.1:WP_027179546.1 277 DPRGYLGEARKAVKDMVCHKIKnVLGSSGKA 307 *********************989*****97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (282 nodes) Target sequences: 1 (307 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 3.09 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory