Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_027177931.1 G496_RS0102800 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000429985.1:WP_027177931.1 Length = 386 Score = 197 bits (500), Expect = 5e-55 Identities = 118/383 (30%), Positives = 199/383 (51%), Gaps = 19/383 (4%) Query: 11 VPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGI 70 + PF VMDV AA + +R ++++ G+P P+ V+ A AL Q Y+ +LG+ Sbjct: 11 ISPFLVMDVLEAAQKMERAGKKVIHMEVGEPDFDTPQCVKDACCKALQDGQTHYTHSLGV 70 Query: 71 PELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRN 130 ELR+AI+ Y++ + + V+P +++T G+S LL F D G+ V ++ P Y CY N Sbjct: 71 EELRNAISDYYKKEYNVDVDPGRIIVTQGTSPAMLLLFTFLLDPGENVILSDPCYACYDN 130 Query: 131 ILSALGCEVVEIPCGPQTRFQ-PTAQMLAEIDPPLRGVVVASPANPTGTVIPPE---ELA 186 ++ E + +P FQ ++ +++ + +++ SP+NP GT++ PE E+A Sbjct: 131 FIAFADGEALRVPIFEDDGFQFRPEEIRKKMNDKTKAIMLNSPSNPAGTLLSPERMKEIA 190 Query: 187 AIASWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWL 246 + W ++SDE+YHGLVY+G T + + +A V+N FSK +AMTG RLG++ Sbjct: 191 EMGPW-------IVSDEIYHGLVYEGKEHTILEY--TDHAFVLNGFSKIFAMTGMRLGYI 241 Query: 247 LVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLR 306 + P R + L NF I ++Q A V+A +A + + +Y R LL LR Sbjct: 242 IAPEKYVRPLQKLCQNFFISANSIAQWAGVAAL-KDAWDDVEKMKQTYNKRRLFLLKRLR 300 Query: 307 RIGIDRLAPTDGAFYVYAD----VSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSF 362 +G + GAFY+ + F S +L + + PGIDF G F Sbjct: 301 EMGFEIKVEPTGAFYILVNAKKLAEKFGGSSYKLAFDILEKAAIGVTPGIDFGKGAEG-F 359 Query: 363 VRISFAGPSGDIEEALRRIGSWL 385 +R+S+A ++ E + R+ ++ Sbjct: 360 IRLSYANSLENLAEGMDRLEKYV 382 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 386 Length adjustment: 30 Effective length of query: 358 Effective length of database: 356 Effective search space: 127448 Effective search space used: 127448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory