Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_028312666.1 H566_RS0118905 chorismate synthase
Query= SwissProt::P12008 (361 letters) >NCBI__GCF_000482785.1:WP_028312666.1 Length = 358 Score = 449 bits (1154), Expect = e-131 Identities = 221/354 (62%), Positives = 275/354 (77%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 M+GNT G F VTTFGESHG A+GC++DG PPG+ L+EAD+Q +LDRRRPGTSR+ TQR+ Sbjct: 1 MSGNTFGHTFSVTTFGESHGPAIGCVIDGCPPGMALSEADIQPELDRRRPGTSRHVTQRQ 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 EPD+V+ILSGV+EG TTGT I LLI N DQRS+DY I FRPGHAD+ Y KYG+RD Sbjct: 61 EPDRVEILSGVYEGKTTGTPIALLIRNEDQRSKDYGNIAATFRPGHADFAYWNKYGIRDP 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC 180 RGGGRSSAR TA VAAGA+AKK+LAE+ G+ G ++Q+G+I + D +++ N FF Sbjct: 121 RGGGRSSARLTAPVVAAGAVAKKWLAERHGVSFSGWMSQLGEIAIPFVDATEIPNNAFFA 180 Query: 181 PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV 240 P+ + L+ M AL+K GDS GA++ VVA G+PAG GEP+FD+LDADIA A+M INAV Sbjct: 181 PNAAVVPELEAYMDALRKAGDSCGARIEVVARGLPAGWGEPLFDKLDADIAFAMMGINAV 240 Query: 241 KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV 300 KGVEIGDGF V+ +GS++ DEIT +GF SNHAGG+LGGIS+GQ + +A+KPTSSI V Sbjct: 241 KGVEIGDGFACVSQKGSEHGDEITPEGFLSNHAGGVLGGISTGQDLRVSLAIKPTSSIRV 300 Query: 301 PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADV 354 P ++I+ GE + T GRHDPCVGIRA PIAEAMLA+VL+DH LR RAQ DV Sbjct: 301 PRKSIDIHGEPTVVETHGRHDPCVGIRATPIAEAMLALVLIDHALRHRAQCGDV 354 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 358 Length adjustment: 29 Effective length of query: 332 Effective length of database: 329 Effective search space: 109228 Effective search space used: 109228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_028312666.1 H566_RS0118905 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.8930.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-142 460.6 0.0 1.8e-142 460.4 0.0 1.0 1 lcl|NCBI__GCF_000482785.1:WP_028312666.1 H566_RS0118905 chorismate syntha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000482785.1:WP_028312666.1 H566_RS0118905 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 460.4 0.0 1.8e-142 1.8e-142 1 350 [. 10 350 .. 10 351 .. 0.98 Alignments for each domain: == domain 1 score: 460.4 bits; conditional E-value: 1.8e-142 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 +++ttfGeSHg+a+g++idG+P+g+ l+e+diq+el+rRrpg+sr+ ++r+E D+veilsGv+eGkTtG lcl|NCBI__GCF_000482785.1:WP_028312666.1 10 FSVTTFGESHGPAIGCVIDGCPPGMALSEADIQPELDRRRPGTSRHVTQRQEPDRVEILSGVYEGKTTG 78 789****************************************************************** PP TIGR00033 70 aPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLke 138 +Pialli+N+d+rskdy +i+ ++RPgHad++y++KYgi+d +gggrsSaR Ta vaaGavakk+L+e lcl|NCBI__GCF_000482785.1:WP_028312666.1 79 TPIALLIRNEDQRSKDYGNIAATFRPGHADFAYWNKYGIRDPRGGGRSSARLTAPVVAAGAVAKKWLAE 147 ********************************************************************* PP TIGR00033 139 tagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvv 207 +g+ +++++lge+++++ a+ ++ ++ +++p+a e+e+++d ++k+gds G+++evv+ lcl|NCBI__GCF_000482785.1:WP_028312666.1 148 RHGVSFSGWMSQLGEIAIPFVDAT-----EIPNNAFFAPNAAVVPELEAYMDALRKAGDSCGARIEVVA 211 *******************86555.....588999********************************** PP TIGR00033 208 snvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGi 276 +++p+g+Geplfdklda +a a+++inAvKgveiGdGF+ +s++Gse+ De++ e + +n+ GG+ lcl|NCBI__GCF_000482785.1:WP_028312666.1 212 RGLPAGWGEPLFDKLDADIAFAMMGINAVKGVEIGDGFACVSQKGSEHGDEITPE----GFLSNHAGGV 276 **************************************************88655....69******** PP TIGR00033 277 eGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladall 345 +GGi++G+d+rv+ a+Kp+++i+ p+k++d+++++++ t+gRhDpcv +ra+p++Eam+alvl+d++l lcl|NCBI__GCF_000482785.1:WP_028312666.1 277 LGGISTGQDLRVSLAIKPTSSIRVPRKSIDIHGEPTVVETHGRHDPCVGIRATPIAEAMLALVLIDHAL 345 ********************************************************************* PP TIGR00033 346 ekras 350 ++ra+ lcl|NCBI__GCF_000482785.1:WP_028312666.1 346 RHRAQ 350 *9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.68 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory