Align Kynurenine--oxoglutarate transaminase 1; Kynurenine--oxoglutarate transaminase I; Cysteine-S-conjugate beta-lyase; Glutamine transaminase K; GTK; Glutamine--phenylpyruvate transaminase; Kynurenine aminotransferase 1; Kynurenine aminotransferase I; KATI; EC 2.6.1.7; EC 4.4.1.13; EC 2.6.1.64 (characterized)
to candidate WP_028310306.1 H566_RS0103260 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::Q08415 (423 letters) >NCBI__GCF_000482785.1:WP_028310306.1 Length = 422 Score = 206 bits (523), Expect = 1e-57 Identities = 130/433 (30%), Positives = 206/433 (47%), Gaps = 51/433 (11%) Query: 9 RLDGIDQNLWVEFGKLTKEYDVVNLGQGFPDFSPPDFATQAFQQATSGNFMLNQYTRAFG 68 RL + ++ L E+ +NLGQGFPDF + ++A N LNQY G Sbjct: 13 RLPRVGTTIFTTMSALATEHGAINLGQGFPDFDCDPALIECVERAMRAN--LNQYPPMAG 70 Query: 69 YPPLTNVLASFFGKLLGQEMDPLTNVLVTVGAYGALFTRFQALVDEGDEVIIMEPAFDCY 128 P L +A ++ G+ DP + +T G A+ T A+V GDEV+++EP +D Y Sbjct: 71 LPALREAVAGKIARMHGRRYDPAGEITITAGGTQAILTAILAVVHPGDEVVVIEPVYDSY 130 Query: 129 EPMTMMAGGCPVFVTLK-------PSP-----------------APKGKLGASNDWQLDP 164 P +AGG V V L+ PS AP G G + DW Sbjct: 131 LPNIALAGGVAVRVPLRRADVGGRPSAPEAGAAADDAPAIDAPAAPAGATGFAIDWDA-- 188 Query: 165 AELASKFTPRTKILVLNTPNNPLGKVFSRMELELVANLCQQHDVVCISDEVYQWLVYDGH 224 LA+ TPRT+++++N+P+NP G +L+ +A L + D++ + DEVY+ +V+DG Sbjct: 189 --LAAAITPRTRLVLINSPHNPTGASLDDADLDRLAALVRGTDILLLGDEVYEHMVFDGR 246 Query: 225 QHVSIASLPGMWDRTLTIGSAGKSFSATGWKVGWVMGPDNIMKHLRTVHQNSIFHCPTQA 284 +H S+A + R+ + S GK+F TGWKVG+ P + R VHQ ++F T Sbjct: 247 EHQSLARHDELAARSFVVSSFGKTFHVTGWKVGYCAAPPALTAEFRKVHQFNVFTVNTPM 306 Query: 285 QAAVAQCFEREQQHFGQPSSYFLQLPQAMELNRDHMIRSLQSVGLKLWISQGSYFLIADI 344 QA +A + R+ + + ++ + RD L G +L G+YF A+ Sbjct: 307 QAGLAD-YLRDPAPWRDLAGFY-------QRKRDRFRAGLAGSGFRLLPCSGTYFQCAEY 358 Query: 345 SDFKSKMPDLPGAEDEPYDRRFAKWMIKNMGLVGIPVSTFFSRPHQKDFDHYIRFCFVKD 404 + + L + F +W+ +G+ IP+S+F+ P + +RFCF K Sbjct: 359 AGVTAAPSGLSELD-------FCRWLTTEVGVAAIPLSSFYDEPTENGI---VRFCFAKR 408 Query: 405 KATLQAMDERLRK 417 TL DE +R+ Sbjct: 409 DDTL---DEAIRR 418 Lambda K H 0.322 0.137 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 422 Length adjustment: 32 Effective length of query: 391 Effective length of database: 390 Effective search space: 152490 Effective search space used: 152490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory