Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_051378992.1 H566_RS0118805 O-succinylhomoserine sulfhydrylase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000482785.1:WP_051378992.1 Length = 403 Score = 289 bits (740), Expect = 9e-83 Identities = 164/394 (41%), Positives = 238/394 (60%), Gaps = 17/394 (4%) Query: 16 SLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEH--------QGFEYSRTHNPTRF 67 ++ TLA+ G + G ++ TS+Y S E +G YSR NPT Sbjct: 13 AIETLAVRAGTARS-GFGEHAEAMFLTSSYVFGSAAEAADRFSNKVEGNVYSRFTNPTVT 71 Query: 68 AYERCVAALEGGTRAFAFASGMAATSTV-MELLDAGSHVVAMDDLYGGTFRLFERVRRRT 126 +E+ +AALEG A A ASGM+A T M +L AG HVVA L+G T +LF + + Sbjct: 72 MFEQRLAALEGAEAALATASGMSAILTCCMGVLKAGDHVVASTGLFGSTVQLFNNILSKF 131 Query: 127 AGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDN 186 G+ S+V DPAA++AA+R +TK+ ++ETP+NPM++L DI A+A +A+ G L VVDN Sbjct: 132 -GITTSYVSPADPAAWRAAVRPETKLFYVETPSNPMMELADIPALASVAKDAGALLVVDN 190 Query: 187 TFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQ 246 F +P LQ+PL LGAD+V+HSATKY++G ++GG A+VG A + +QM + G Sbjct: 191 CFCTPALQQPLKLGADVVIHSATKYIDGQGRVLGG-AIVGSKAFIKDQMLPFLRTAGPTL 249 Query: 247 GPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQM 306 PF++++ L+GL+TL +RM ENALA+A+WLE P +++VIYPGL SHPQH LAKRQ Sbjct: 250 SPFNAWVLLKGLETLAIRMERQSENALAVARWLEAQPQVKRVIYPGLESHPQHELAKRQQ 309 Query: 307 SGFGGIVSIVLKGGFDA-----AKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVA 361 G ++S L+G A R + T L ++ +LG + + HPA TH + Sbjct: 310 KTGGAVLSFELRGETPEQQRTNAWRVIDNTRLVSITANLGDTRTTITHPATTTHGRVAPE 369 Query: 362 RREQLGISDALVRLSVGIEDLGDLRGDLERALVN 395 R GI++ ++RL+VG+E DL DL R + + Sbjct: 370 VRAAAGITEGMIRLAVGLESPEDLCRDLARGMTD 403 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 403 Length adjustment: 31 Effective length of query: 366 Effective length of database: 372 Effective search space: 136152 Effective search space used: 136152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory