Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_028310802.1 H566_RS0106475 aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000482785.1:WP_028310802.1 Length = 396 Score = 291 bits (744), Expect = 3e-83 Identities = 165/380 (43%), Positives = 223/380 (58%), Gaps = 7/380 (1%) Query: 9 AGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVAL 68 A + PF+ M++ AA +R DLV L+ G+P APEPV+ AA AA+ Y+ AL Sbjct: 13 ANIQPFHAMEIVKAADALERAGRDLVYLALGEPDFAAPEPVQRAALAAMQSGATRYTAAL 72 Query: 69 GIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCY 128 G+PELR+AI+ Y R + + V P+ +V+T G+SG LLA LA D G V M+ PGYPC Sbjct: 73 GLPELREAISGFYARHYALDVPPERIVVTAGASGALLLACLATLDPGSEVLMSDPGYPCN 132 Query: 129 RNILSALGCEVVEIPCGPQTRFQPTAQMLA-EIDPPLRGVVVASPANPTGTVIPPEELAA 187 R+ ++A+ +PCGP+ RFQ A+ +A R ++ASP+NPTGT + P ELAA Sbjct: 133 RHFVAAVDAVPRALPCGPEQRFQLDARQIATHWTARTRAALLASPSNPTGTSVLPAELAA 192 Query: 188 IASWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNA-----VVVNSFSKYYAMTGWR 242 IA + LI DE+YH L Y A T+ W S A + VNSFSK++ MTGWR Sbjct: 193 IAREVRSRHGWLIVDEIYHALSYDLADPTT-GWAPSALALGDDIITVNSFSKFFGMTGWR 251 Query: 243 LGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLL 302 LGWL++P + RAV+ L N IC LSQ AA++ F +A A + R+ LL Sbjct: 252 LGWLVLPPSVVRAVEKLAQNLFICASTLSQRAALACFGDDAMATFLARRDEFRRRRAFLL 311 Query: 303 DGLRRIGIDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSF 362 LR +G+D DGAFY+YADVS DS AF +++L + GV + PG DF A F Sbjct: 312 PALRDLGLDVPVTPDGAFYIYADVSRHAPDSDAFANRMLEEAGVVLVPGKDFGAAGTRDF 371 Query: 363 VRISFAGPSGDIEEALRRIG 382 VR S+A IE A+ R+G Sbjct: 372 VRFSYATGYERIELAVERMG 391 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 28 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 396 Length adjustment: 31 Effective length of query: 357 Effective length of database: 365 Effective search space: 130305 Effective search space used: 130305 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory