Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate WP_027458322.1 K420_RS0112285 phosphoserine phosphatase SerB
Query= SwissProt::Q12A06 (236 letters) >NCBI__GCF_000519045.1:WP_027458322.1 Length = 280 Score = 237 bits (605), Expect = 2e-67 Identities = 127/220 (57%), Positives = 158/220 (71%), Gaps = 5/220 (2%) Query: 15 ATPDLKLSDFKLIAFDMDSTLINIECVDEIADAAGRKAEVAAITEAAMRGEISDYKESLR 74 A P KLSDF LI FDMDSTLI IEC+DE+AD AG+KAEV+ +TEAAMRGEI DY+ESLR Sbjct: 63 AQPGKKLSDFGLICFDMDSTLITIECIDELADFAGKKAEVSEVTEAAMRGEI-DYRESLR 121 Query: 75 QRVALLKGVSVASMDEVYRTRLRLNPGAARLVQACKDAGLKVLLVSGGFTFFTDRIRDEL 134 +R+ALL G+ + VY RL L+ GA L++AC++AGL+ ++SGGFT+FT+R+R EL Sbjct: 122 RRLALLAGLDARVLARVYGERLLLSHGARELLEACQNAGLRTAILSGGFTYFTERLRIEL 181 Query: 135 GIDYTRSNVLETTDGLLTGRMVDQPWGDICDGEEKRKMLLETCGQLGISPRQAIAMGDGA 194 G D+ SN LE + G LTG++V GDI D K + +LG+ Q IA GDGA Sbjct: 182 GFDFATSNELEISGGKLTGKVV----GDIVDASAKAHHIARLTDELGLRKEQVIACGDGA 237 Query: 195 NDLPMMGEAGLSVAYHAKPRVREQAMVAINEGGLDRLLEL 234 NDL MM +AGLSVA+HAKP R +A VAIN GGLD LL L Sbjct: 238 NDLMMMAQAGLSVAFHAKPATRAKADVAINFGGLDSLLNL 277 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 280 Length adjustment: 24 Effective length of query: 212 Effective length of database: 256 Effective search space: 54272 Effective search space used: 54272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_027458322.1 K420_RS0112285 (phosphoserine phosphatase SerB)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.23210.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-73 231.8 0.1 4.5e-73 231.5 0.1 1.0 1 lcl|NCBI__GCF_000519045.1:WP_027458322.1 K420_RS0112285 phosphoserine pho Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000519045.1:WP_027458322.1 K420_RS0112285 phosphoserine phosphatase SerB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 231.5 0.1 4.5e-73 4.5e-73 11 218 .. 69 277 .. 61 278 .. 0.96 Alignments for each domain: == domain 1 score: 231.5 bits; conditional E-value: 4.5e-73 TIGR00338 11 lkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslreRvkllkglpvellkk 79 l+ +l++fD+Dstli++E+Ide+a aG + eVse+Te Amrge+d++eslr R++ll gl++ +l + lcl|NCBI__GCF_000519045.1:WP_027458322.1 69 LSDFGLICFDMDSTLITIECIDELADFAGKKAEVSEVTEAAMRGEIDYRESLRRRLALLAGLDARVLAR 137 56678************************************************************9999 PP TIGR00338 80 ve.eklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLevedgkltGkvegei 147 v+ e+l l +G++el ++ +++g+++a++SGgF++++e+l+ +Lg d++ +N+Le++ gkltGkv g+i lcl|NCBI__GCF_000519045.1:WP_027458322.1 138 VYgERLLLSHGARELLEACQNAGLRTAILSGGFTYFTERLRIELGFDFATSNELEISGGKLTGKVVGDI 206 97588999************************************************************* PP TIGR00338 148 vdesakaktllkllekegislektvavGDGanDlsmikaAglgiafnakpvlkekadiviekkdltdil 216 vd+saka+ + +l+ + g+ +e+++a GDGanDl m+++Agl +af+akp+ + kad++i+ l ++l lcl|NCBI__GCF_000519045.1:WP_027458322.1 207 VDASAKAHHIARLTDELGLRKEQVIACGDGANDLMMMAQAGLSVAFHAKPATRAKADVAINFGGLDSLL 275 *************************************************************99998887 PP TIGR00338 217 el 218 +l lcl|NCBI__GCF_000519045.1:WP_027458322.1 276 NL 277 65 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (280 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.06 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory