Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_024851548.1 N745_RS0107705 chorismate synthase
Query= SwissProt::P12008 (361 letters) >NCBI__GCF_000526715.1:WP_024851548.1 Length = 367 Score = 509 bits (1310), Expect = e-149 Identities = 244/354 (68%), Positives = 295/354 (83%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 M+GNT+GQ FRVTTFGESHG+ALG I+DG PPG+ L+E D+Q +LDRR+PGTS++ T RR Sbjct: 1 MSGNTLGQNFRVTTFGESHGIALGAIIDGCPPGMALSEEDIQVELDRRKPGTSKHATARR 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 E D+V+ILSGVFEG TTGT IGL+I NTDQRS+DY+ + + FRP HADYTY QKYG+RDY Sbjct: 61 EDDKVQILSGVFEGKTTGTPIGLIIHNTDQRSKDYAKVAETFRPSHADYTYTQKYGIRDY 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC 180 RGGGRSSARETAMRVAAGAIAKKYL E+ GIEI+G L+Q+G I ++ W N +FC Sbjct: 121 RGGGRSSARETAMRVAAGAIAKKYLKERLGIEIKGYLSQLGPITVEGVTWPFDNDNEYFC 180 Query: 181 PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV 240 P P+K + + E M L K+ DS+GAK+T+VA VP GLGEPVFDRLDAD+AHALMSINAV Sbjct: 181 PSPEKREEIREYMDNLLKQKDSVGAKITIVAKNVPVGLGEPVFDRLDADLAHALMSINAV 240 Query: 241 KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV 300 KGVEIGDGF V A RG+++RDE++ +GF +NH+GGILGGIS+GQ I+AH+ALKPTSSI Sbjct: 241 KGVEIGDGFAVAAQRGTEHRDEMSPEGFLANHSGGILGGISTGQDIVAHIALKPTSSIMT 300 Query: 301 PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADV 354 PG++INR GE EM+TKGRHDPCVGIRA PIAEA +A+VLMDH +R RAQN DV Sbjct: 301 PGKSINRDGEATEMVTKGRHDPCVGIRATPIAEAKIALVLMDHFMRNRAQNGDV 354 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 367 Length adjustment: 29 Effective length of query: 332 Effective length of database: 338 Effective search space: 112216 Effective search space used: 112216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_024851548.1 N745_RS0107705 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.25584.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-146 472.4 0.5 4.4e-146 472.3 0.5 1.0 1 lcl|NCBI__GCF_000526715.1:WP_024851548.1 N745_RS0107705 chorismate syntha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000526715.1:WP_024851548.1 N745_RS0107705 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 472.3 0.5 4.4e-146 4.4e-146 1 350 [. 10 350 .. 10 351 .. 0.97 Alignments for each domain: == domain 1 score: 472.3 bits; conditional E-value: 4.4e-146 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 +r+ttfGeSHg algaiidG+P+g+ l+eediq el+rR+pg+s++++ r+E+D+v+ilsGvfeGkTtG lcl|NCBI__GCF_000526715.1:WP_024851548.1 10 FRVTTFGESHGIALGAIIDGCPPGMALSEEDIQVELDRRKPGTSKHATARREDDKVQILSGVFEGKTTG 78 89******************************************************************* PP TIGR00033 70 aPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLke 138 +Pi l+i+N+d+rskdy +++e++RP+Hadyty++KYgi+d++gggrsSaReTa+rvaaGa+akk+Lke lcl|NCBI__GCF_000526715.1:WP_024851548.1 79 TPIGLIIHNTDQRSKDYAKVAETFRPSHADYTYTQKYGIRDYRGGGRSSARETAMRVAAGAIAKKYLKE 147 ********************************************************************* PP TIGR00033 139 tagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvv 207 giei++y+++lg +++e + ++++ +cp++e+++e++e++d++ k++dsvG+++++v+ lcl|NCBI__GCF_000526715.1:WP_024851548.1 148 RLGIEIKGYLSQLGPITVEGVTWPF-----DNDNEYFCPSPEKREEIREYMDNLLKQKDSVGAKITIVA 211 *******************866553.....34589********************************** PP TIGR00033 208 snvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGi 276 +nvpvglGep+fd+lda la+al+sinAvKgveiGdGF+ a +rG e+ De+ e + +n+sGGi lcl|NCBI__GCF_000526715.1:WP_024851548.1 212 KNVPVGLGEPVFDRLDADLAHALMSINAVKGVEIGDGFAVAAQRGTEHRDEMSPE----GFLANHSGGI 276 **************************************************88655....699******* PP TIGR00033 277 eGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladall 345 +GGi++G+di+ +ia+Kp+++i +p k+++ +++ + +tkgRhDpcv +ra+p++Ea +alvl+d+++ lcl|NCBI__GCF_000526715.1:WP_024851548.1 277 LGGISTGQDIVAHIALKPTSSIMTPGKSINRDGEATEMVTKGRHDPCVGIRATPIAEAKIALVLMDHFM 345 ********************************9999999****************************** PP TIGR00033 346 ekras 350 ++ra+ lcl|NCBI__GCF_000526715.1:WP_024851548.1 346 RNRAQ 350 99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (367 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.40 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory