Align Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 (characterized)
to candidate WP_024850151.1 N745_RS0100330 shikimate dehydrogenase
Query= SwissProt::Q9KVT3 (278 letters) >NCBI__GCF_000526715.1:WP_024850151.1 Length = 281 Score = 262 bits (670), Expect = 5e-75 Identities = 144/279 (51%), Positives = 189/279 (67%), Gaps = 8/279 (2%) Query: 3 SQIDQYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQCVPVDG--FTEAAKHFFAQGGR 60 +QID YAV GNPI HSKSP IH LFA QT Q ++Y A + + F A + A+G + Sbjct: 2 NQIDCYAVVGNPIAHSKSPQIHRLFAEQTNQELVYEAIRIDAEKTPFNYAVRQLMAKGYK 61 Query: 61 GCNVTVPFKEEAYRFADRLTERARLAGAVNTLKKLDDGEILGDNTDGEGLVQDL-LAQQV 119 G NVTVPFK +A+ FAD LT RA+ A AVNTL DDG++LGDNTDG GLV D+ L + Sbjct: 62 GLNVTVPFKLDAFDFADELTARAQTAQAVNTLVFHDDGKVLGDNTDGIGLVNDIELNGKR 121 Query: 120 LLKGATILLIGAGGAARGVLKPLLDQQPASITVTNRTFAKAEQLAELVAAYGEVKAQAFE 179 L K +L++GAGGA +G+L+PLL++QP + + NRT AKAE+LA+ A + A +E Sbjct: 122 LFKNQRVLILGAGGAVQGILQPLLEKQPICVHIANRTAAKAEELAQRFAGDISITASGWE 181 Query: 180 Q--LKQSYDVIINSTSASLDGELPAIDPVIFSSRSVCYDMMYGKGYTVFNQWARQH--GC 235 + LK YD+IIN TSASL+ ++P I S+ YDMMYG TVF WA+QH C Sbjct: 182 EVPLKPGYDIIINGTSASLENKVPPIQEDCLKLDSLVYDMMYGAEPTVFMAWAKQHQPDC 241 Query: 236 AQAIDGLGMLVGQAAESFMLWRGLRPGTKQILRELRKNL 274 +DGLGMLVGQAAE+F LWRG+RP T I++++R ++ Sbjct: 242 T-VMDGLGMLVGQAAEAFNLWRGVRPETASIIQQIRDSI 279 Lambda K H 0.320 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 6 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 281 Length adjustment: 26 Effective length of query: 252 Effective length of database: 255 Effective search space: 64260 Effective search space used: 64260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_024850151.1 N745_RS0100330 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.20031.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-87 278.7 0.0 2.4e-87 278.5 0.0 1.0 1 lcl|NCBI__GCF_000526715.1:WP_024850151.1 N745_RS0100330 shikimate dehydro Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000526715.1:WP_024850151.1 N745_RS0100330 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 278.5 0.0 2.4e-87 2.4e-87 2 269 .. 6 279 .. 5 280 .. 0.96 Alignments for each domain: == domain 1 score: 278.5 bits; conditional E-value: 2.4e-87 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveiee..lekalsgikalglkGvnvTvPfKeevl 68 +++v+Gnpi+hSksp ih +++q+++el+Y a+ ++ e+ +++a+ ++ a+g kG+nvTvPfK ++ lcl|NCBI__GCF_000526715.1:WP_024850151.1 6 CYAVVGNPIAHSKSPQIHRLFAEQTNQELVYEAIRIDAEKtpFNYAVRQLMAKGYKGLNVTVPFKLDAF 74 79*****************************999888887779************************** PP TIGR00507 69 ellDeieesakligavNTlk.ledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavale 135 +++De++ +a++++avNTl+ +dgk++g+nTDgiGlv ++e ++l +++rvli+GAGGa ++++ + lcl|NCBI__GCF_000526715.1:WP_024850151.1 75 DFADELTARAQTAQAVNTLVfHDDGKVLGDNTDGIGLVNDIELnGKRLFKNQRVLILGAGGAVQGILQP 143 ********************8899***************99987788989******************* PP TIGR00507 136 Llka.dkeviiaNRtvekaeelaerlqelgeilalsleevelkk.vdliinatsaglsgeideaevkae 202 Ll++ + v iaNRt +kaeela+r++ +i+a eev+lk +d+iin tsa+l++++ ++++++ lcl|NCBI__GCF_000526715.1:WP_024850151.1 144 LLEKqPICVHIANRTAAKAEELAQRFAGDISITASGWEEVPLKPgYDIIINGTSASLENKV--PPIQED 210 99764889********************999************99****************..****** PP TIGR00507 203 llkegklvvDlvynpletpllkeakkkg..tkvidGlgMlvaQaalsFelwtgvepdvekvfealkekl 269 lk ++lv+D++y t+++++ak+++ + v+dGlgMlv Qaa +F+lw+gv p+ ++++++++ + lcl|NCBI__GCF_000526715.1:WP_024850151.1 211 CLKLDSLVYDMMYGAEPTVFMAWAKQHQpdCTVMDGLGMLVGQAAEAFNLWRGVRPETASIIQQIRDSI 279 **************************9888*********************************999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (281 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 8.15 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory