Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_024851450.1 N745_RS0107205 O-succinylhomoserine sulfhydrylase
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_000526715.1:WP_024851450.1 Length = 393 Score = 474 bits (1221), Expect = e-138 Identities = 231/385 (60%), Positives = 297/385 (77%), Gaps = 1/385 (0%) Query: 20 DTLAVRAGQRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGNVYSRYTNPTVRTFE 79 +TLA+RAG +T E E+ EA+F TSS+ +++A AA RF+G GNVYSR++NPTVRTFE Sbjct: 8 ETLAIRAGYDQTAEQENSEAIFPTSSFRYQSAQQAADRFSGAEKGNVYSRFSNPTVRTFE 67 Query: 80 ERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGIQ 139 R+AALEG E V TASGMSAIL+ M+LC SGDHV+ S S+FG+T LF+KY K+FG+ Sbjct: 68 NRLAALEGGEACVGTASGMSAILSTFMALCESGDHVVSSSSIFGTTKVLFNKYLKKFGLD 127 Query: 140 VDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLAVDNCFCT 199 V + +D+ W+ A KPNTK F+ESPSNPL + DI+AL+++A A+L VDNCFCT Sbjct: 128 VTFVSQTDVDEWKNAVKPNTKALFLESPSNPLTHIADISALSQLAKENDAVLIVDNCFCT 187 Query: 200 PALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQM-KEVVGFLRTAGPTLSPFNA 258 P LQQPL LGAD+VIHSATK++DGQGR +GG V G + +EV GFLRTAGP++SPFNA Sbjct: 188 PVLQQPLSLGADIVIHSATKFLDGQGRAIGGAVVGSEALVGEEVRGFLRTAGPSMSPFNA 247 Query: 259 WLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQQSGFGA 318 W+FLKGLETL IRM+AH A+ALA WL++ P +E V+Y GL +HPQ++LA++QQ G G Sbjct: 248 WIFLKGLETLSIRMEAHCQRAMALANWLDQHPAVETVFYPGLKTHPQYDLAQKQQKGAGG 307 Query: 319 VVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAGIGDS 378 +V+F VKGGR AW ID T+MVSIT NLGD KT+I HPATT+H R+ ++R GI D+ Sbjct: 308 LVTFRVKGGRSEAWSVIDNTKMVSITANLGDVKTSITHPATTTHCRVPEDERLATGITDN 367 Query: 379 LIRVAVGLEDLDDLKADMARGLAAL 403 L+RV+VGLE ++DLKAD+ARGL L Sbjct: 368 LLRVSVGLESIEDLKADLARGLDKL 392 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 393 Length adjustment: 31 Effective length of query: 372 Effective length of database: 362 Effective search space: 134664 Effective search space used: 134664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory