Align Metal-independent phosphoserine phosphatase; iPSP; Phosphoglycerate mutase-like protein 3; EC 3.1.3.3 (characterized)
to candidate WP_084471813.1 HALAL_RS0102050 histidine phosphatase family protein
Query= SwissProt::F4KI56 (238 letters) >NCBI__GCF_000527155.1:WP_084471813.1 Length = 219 Score = 80.9 bits (198), Expect = 2e-20 Identities = 64/201 (31%), Positives = 101/201 (50%), Gaps = 16/201 (7%) Query: 24 VTEIVLVRHGETTWNAAGRIQGQIESDLNEVGLKQAVAIAERLGKEERPVAVYSSDLKRA 83 VT++++VRHG T WN GRIQG + L++VG++QA A+ L + P + SSDL RA Sbjct: 6 VTQLIVVRHGRTEWNDTGRIQGASDIALDDVGVEQAARAADALASYQ-PDRIISSDLVRA 64 Query: 84 KDTALMIAKTCFCPEVIEVPDLKERHVGSLQGLYWKEGAEKEPEAYSAFFSSQNDLEIPG 143 DTA +A+ EV L+ER G +GL E +++ PE + + S + L+ P Sbjct: 65 SDTAKRVAEVTGV-EVELDERLRERSYGPWEGLRMSEISQRYPEDHERWRSGK-PLKHP- 121 Query: 144 GGESFDQLADRSMDALEQIAKKHKGERVIVVTHGGVLRAIYLRITQASSAGKLLNASVNV 203 E+++ L RS ++++ K ++ THGG R I S A ++ Sbjct: 122 DIETWEALRKRSGGLVDEL--KSGDGVTLIFTHGGTARQIVGAALDWSQEDTGTLAGLDN 179 Query: 204 VHLRDQKWIIDSWSDVSHLSS 224 VH W+D+ + S Sbjct: 180 VH----------WADIREMKS 190 Lambda K H 0.315 0.132 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 219 Length adjustment: 23 Effective length of query: 215 Effective length of database: 196 Effective search space: 42140 Effective search space used: 42140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory