Align Threonine synthase; TS; EC 4.2.3.1 (uncharacterized)
to candidate WP_025272738.1 HALAL_RS0103875 threonine synthase
Query= curated2:Q58860 (405 letters) >NCBI__GCF_000527155.1:WP_025272738.1 Length = 421 Score = 246 bits (628), Expect = 9e-70 Identities = 144/382 (37%), Positives = 219/382 (57%), Gaps = 9/382 (2%) Query: 5 CIKCGKTYDVDEIIYTCECGGLLEIIYDYEEIKDKVSEEKLRKREIGVWRYLEYLPVKD- 63 C C KTYD+ +C G LE+ YD + +V+ E++ +WRY LPV + Sbjct: 18 CRNCEKTYDLIAQHACWQCFGPLEVEYDSTALA-RVTREQIEAGPHNIWRYAGLLPVGNI 76 Query: 64 ESKIVSLCEGGTPLYRCNNLEKELGIKELYVKNEGANPTGSFKDRGMTVGVTRANELGVE 123 S VSL G TPL +NL +ELG+++L+VK++ ANPT SFKDR ++V +T A LG + Sbjct: 77 ASDRVSLNPGMTPLIEADNLARELGMRKLWVKDDSANPTHSFKDRVVSVALTAAGYLGFD 136 Query: 124 VVGCASTGNTSASLAAYSARSGKKCIVLLPEGKVALGKLAQAMFYGAKVIQVKGNFDDAL 183 CASTGN + S+AA+ AR+G++ IV +P + GK+ YG ++ V+G++DD Sbjct: 137 RFACASTGNLANSVAAHGARAGRESIVFIPH-DLERGKVITTAVYGGSLVAVRGSYDDVN 195 Query: 184 DMVKQLAK----EKLIYLLNSINPFRLEGQKTIAFEICDQLNWQVPDRVIVPVGNAGNIS 239 + L + E ++ +I PF EG KT+ +E+ +QL W++P++V++P + ++ Sbjct: 196 RLCSMLCETDEFENTAFVNVNIRPFYAEGSKTLGYEVAEQLGWRLPEQVVIPAASGELLT 255 Query: 240 AIWKGFKEFEITGIIDE-LPKMTGIQADGAKPIVEAFRKRAKDIIPYKNPETIATAIRIG 298 + K F + G+ D ++ G Q+ G PI +AF I P K P IA ++ IG Sbjct: 256 KVHKAFDDCVDIGLTDSGKVRVFGAQSAGCSPISDAFNADTDVIDPVK-PTGIAKSLNIG 314 Query: 299 NPVNAPKALDAIYSSGGYAEAVTDEEIVEAQKLLARKEGIFVEPASASSIAGLKKLLEEG 358 +P P A+++ S+GG + V D+EI E +LLA GIF E A S+A L+KLL +G Sbjct: 315 DPAAGPYAIESARSTGGAFDKVDDDEIREGIRLLAATTGIFAETAGGVSVAVLRKLLRDG 374 Query: 359 IIDRDERIVCITTGHGLKDPDA 380 +D D V TG GLK DA Sbjct: 375 KLDPDAETVVYNTGEGLKTLDA 396 Lambda K H 0.317 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 27 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 421 Length adjustment: 31 Effective length of query: 374 Effective length of database: 390 Effective search space: 145860 Effective search space used: 145860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_025272738.1 HALAL_RS0103875 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.6095.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-77 246.5 0.0 2.4e-77 246.3 0.0 1.0 1 lcl|NCBI__GCF_000527155.1:WP_025272738.1 HALAL_RS0103875 threonine syntha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000527155.1:WP_025272738.1 HALAL_RS0103875 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 246.3 0.0 2.4e-77 2.4e-77 1 339 [. 64 394 .. 64 395 .. 0.97 Alignments for each domain: == domain 1 score: 246.3 bits; conditional E-value: 2.4e-77 TIGR00260 1 vvryreilevt..ekdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltk 67 ++ry+ +l+v +d v+l+ g+t+l+++++la+e+g+++l+vk+++++Pt +FKDr+ v+v+lt+ lcl|NCBI__GCF_000527155.1:WP_025272738.1 64 IWRYAGLLPVGniASDRVSLNPGMTPLIEADNLARELGMRKLWVKDDSANPTHSFKDRV---VSVALTA 129 8*********9899*********************************************...******* PP TIGR00260 68 alelgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDda 136 a lg + +cA++G++++++a a+ ++a+ + +v++P++ ++ +k++t+ +++ ++a++G +Dd+ lcl|NCBI__GCF_000527155.1:WP_025272738.1 130 AGYLGFDRFACASTGNLANSVA-AHGARAGRESIVFIPHD-LE--RGKVITTAVYGGSLVAVRGSYDDV 194 **********************.*****************.99..************************ PP TIGR00260 137 qdlvkeifedke..klklnsvNsinparieaqktyafeiveqlgkespdkvvvpvpsg.nfgailkGfl 202 ++l+ ++e +e ++ +++vN i p++ e++kt+ +e++eqlg++ p++vv+p +sg ++++++k+f lcl|NCBI__GCF_000527155.1:WP_025272738.1 195 NRLCSMLCETDEfeNTAFVNVN-IRPFYAEGSKTLGYEVAEQLGWRLPEQVVIPAASGeLLTKVHKAFD 262 *********665579*******.67*******************************773689******* PP TIGR00260 203 ekkelg....lpieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnveralelarrslg 267 g ++ ++++ g+++i ++f + d+ ++ ++++++ig p+ ++a e ar+++g lcl|NCBI__GCF_000527155.1:WP_025272738.1 263 DCVDIGltdsGKVRVFGAQSAGCSPISDAFNADTDVIDPVKPTGIAKSLNIGDPAAGPYAIESARSTGG 331 ******9888789******************************************************** PP TIGR00260 268 nledlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevvealtgnkl 336 ++++ d+ei e i++la++ g+++e++++v+va+l+kl+ +g ++dp+ +e+v++ tg++l lcl|NCBI__GCF_000527155.1:WP_025272738.1 332 AFDKV----DDDEIREGIRLLAATTGIFAETAGGVSVAVLRKLLRDG---KLDPD--AETVVYNTGEGL 391 *****....**************************************...*****..************ PP TIGR00260 337 kdp 339 k+ lcl|NCBI__GCF_000527155.1:WP_025272738.1 392 KTL 394 985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (421 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.81 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory