Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_025273454.1 HALAL_RS0107745 PLP-dependent aminotransferase family protein
Query= BRENDA::A0A060PQX5 (417 letters) >NCBI__GCF_000527155.1:WP_025273454.1 Length = 361 Score = 218 bits (555), Expect = 2e-61 Identities = 122/369 (33%), Positives = 211/369 (57%), Gaps = 12/369 (3%) Query: 44 SDVISLAGGLPAPETFPVEIIAEITKEVLEKHAAQALQYGTTKGFTPLRLALAEWMRKRY 103 +DVIS + G P+ + VE + + T L++ A+ YGT+ G+ PLR EW+ ++ Sbjct: 2 NDVISFSRGAPSLDIIDVEGLKQATAAALDEDPARTTTYGTSVGYVPLR----EWIAAKH 57 Query: 104 DIPISKVDIMITSGSQQALDLIGRVFINPGDIVVVEAPTYLAALQAFKYYEPEFVQIPLD 163 D+ + ++++T+GS QA + ++P VVVE PTY L + + + I ++ Sbjct: 58 DV--APENVVVTNGSMQADAFLFDQLVSPDSPVVVERPTYDRTLLGLRNRQGQLHPIGVE 115 Query: 164 DEGMRVDLLEEKLQELEKEGKKVKLVYTIPTFQNPAGVTMSEKRRKRLLELASEYDFLIV 223 +G+ VD LE++L K+G + + + IP FQNPAGVT++E++R RLL LA EYDF I Sbjct: 116 SDGINVDELEQRL----KDGLRPVMAHIIPNFQNPAGVTLTEEKRTRLLALAEEYDFTIF 171 Query: 224 EDNPYGELRYSGEPVKPIKAWDDEGRVMYLGTFSKILAPGFRIGWIAAEPHLIRKLEIAK 283 ED+PY ++R+ G+ + + + D GRV+Y +FSK + PG R G++ LI K+ A Sbjct: 172 EDDPYLDIRFRGQQLPTLLSQDTNGRVVYASSFSKTVCPGLRTGYLIGPADLIAKVAKAA 231 Query: 284 QSVDLCTNPFSQVIAWKYVEGGHLDNHIPNIIEFYKPRRDAMLKALEEFMPEGVRWTKPE 343 + + N +++ +++ + G L+ I + E + R D + +L +P + P+ Sbjct: 232 TNTYIAPNQYAESTIYQFAKSGALERSIATVKEALEARVDQLAASLRAHLP-NASFVVPD 290 Query: 344 GGMFVWVTLPEGIDTKLMLEKAVAKGVAYVPGEAFFAHRDVKNTMRLNFTYVPEEKIREG 403 GG F+WV L EG+D + A+ +GV V G F ++ +RL ++ V ++I EG Sbjct: 291 GGYFLWVDLGEGVDCAKVQAAALDEGVQVVKGTDFVVDGG-ESCLRLAYSAVAVDQIDEG 349 Query: 404 IKRLAETIK 412 ++RLA+ ++ Sbjct: 350 VRRLAKAVE 358 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 361 Length adjustment: 30 Effective length of query: 387 Effective length of database: 331 Effective search space: 128097 Effective search space used: 128097 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory