Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_028949930.1 Q385_RS0101320 branched-chain amino acid transaminase
Query= BRENDA::F0QW25 (314 letters) >NCBI__GCF_000619805.1:WP_028949930.1 Length = 302 Score = 304 bits (779), Expect = 2e-87 Identities = 147/301 (48%), Positives = 211/301 (70%), Gaps = 1/301 (0%) Query: 14 MKYVWVNGKLIPEKEATIPILTHALHYGTSIFEGIRAYWNSDNNNLYVFRARDHYVRFHD 73 M V+ K + E+EA I I T++ HYGT++FEGIRAY+N +N+ +Y ++HY R Sbjct: 1 MGIVYFENKFVEEEEAKISIKTNSFHYGTAVFEGIRAYYNKENDTMYGLFFKEHYQRLFK 60 Query: 74 SAKIMSIKVGYSVDELIDATVELLRANDVHEDVYIRPITFVSASTVNLDIRNLDVTTAII 133 + +I+++++ S+DEL++ T EL++ N+ EDVYIRPI + S + + AI Sbjct: 61 NMRILNMEIEESIDELVEITKELVKRNNHKEDVYIRPIVYFSDLAIGPKLIGYTAKIAIY 120 Query: 134 TVPFGHYLEP-KGIKAKVVSWLRVHNSMFPMKAKVSGIYVNSVIAIIDAKVSGFDEAILL 192 T+P G Y++ KGIKAKV SW+R++++M P + KV+G YVNS +A +A ++G +EAI+L Sbjct: 121 TLPLGDYIDTDKGIKAKVSSWVRLNDNMIPPRLKVTGAYVNSALAKTEALLAGAEEAIVL 180 Query: 193 NRDGYVAEGSGENIFIIKDGILYTPPVYDSILEGITRDTVITIARDLGLTVTEKRITREE 252 N++G+V+EGS ENIFI++DG L TPPV D ILEGITR VI IA DLG++V E+ + R E Sbjct: 181 NKNGFVSEGSAENIFIVRDGKLITPPVSDDILEGITRKAVIDIASDLGISVIERSLARTE 240 Query: 253 LYTADEVFFTGTAAEVTPVVNIDGRVIGNGEPGPIALKVRSYYMDVVHGRVSKYKNWLTP 312 LY ADEVFF GT A+++PV+ IDGR IG+G G I K++ Y D V G+V KYKNW+ Sbjct: 241 LYVADEVFFCGTGAQISPVIEIDGRKIGSGTVGEITKKIKDIYFDAVRGKVEKYKNWIVE 300 Query: 313 I 313 I Sbjct: 301 I 301 Lambda K H 0.321 0.139 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 302 Length adjustment: 27 Effective length of query: 287 Effective length of database: 275 Effective search space: 78925 Effective search space used: 78925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_028949930.1 Q385_RS0101320 (branched-chain amino acid transaminase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.7770.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-115 371.5 2.8 1.6e-115 371.3 2.8 1.0 1 lcl|NCBI__GCF_000619805.1:WP_028949930.1 Q385_RS0101320 branched-chain am Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000619805.1:WP_028949930.1 Q385_RS0101320 branched-chain amino acid transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 371.3 2.8 1.6e-115 1.6e-115 1 296 [. 5 299 .. 5 301 .. 0.97 Alignments for each domain: == domain 1 score: 371.3 bits; conditional E-value: 1.6e-115 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglai..frlkehveRlydsakilrleipysk 67 +++ ++v++e+ak+++ t+++hYGt+vfeGiRaY ++++ ++ +++keh++Rl+++ +il++ei+ s lcl|NCBI__GCF_000619805.1:WP_028949930.1 5 YFENKFVEEEEAKISIKTNSFHYGTAVFEGIRAYYNKENDTMygLFFKEHYQRLFKNMRILNMEIEESI 73 8999******************************9988655522689********************** PP TIGR01122 68 eelvevtkevlrknnlks.aYiRplvyvGaedlglkpk.vdlkveviiaawewgaylgeealekGikvk 134 +elve+tke++++nn k+ +YiRp+vy + dl + pk ++++ +++i++ ++g y+++ +kGik+k lcl|NCBI__GCF_000619805.1:WP_028949930.1 74 DELVEITKELVKRNNHKEdVYIRPIVY--FSDLAIGPKlIGYTAKIAIYTLPLGDYIDT---DKGIKAK 137 ***************9988********..8899999999*******************8...7****** PP TIGR01122 135 vssfrraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPp 203 vss+ r ++n+ip+++k++g+Y+ns+lak+eal aG++eai+L+++G+v+eGs enifiv+dg+l+tPp lcl|NCBI__GCF_000619805.1:WP_028949930.1 138 VSSWVRLNDNMIPPRLKVTGAYVNSALAKTEALLAGAEEAIVLNKNGFVSEGSAENIFIVRDGKLITPP 206 ********************************************************************* PP TIGR01122 204 vsesiLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpv 272 vs+ iL+gitr avi++a++lgi+v e++++r+ely+aDevf+ Gt a + P+ e+Dgrkig+g++G++ lcl|NCBI__GCF_000619805.1:WP_028949930.1 207 VSDDILEGITRKAVIDIASDLGISVIERSLARTELYVADEVFFCGTGAQISPVIEIDGRKIGSGTVGEI 275 ********************************************************************* PP TIGR01122 273 tkklqeaffdlvegktekkeewlt 296 tkk+++ +fd v+gk+ek+++w+ lcl|NCBI__GCF_000619805.1:WP_028949930.1 276 TKKIKDIYFDAVRGKVEKYKNWIV 299 **********************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (302 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.32 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory