Align 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 (characterized)
to candidate WP_028489372.1 Q394_RS0111240 3-dehydroquinate synthase
Query= SwissProt::Q8RU74 (442 letters) >NCBI__GCF_000621325.1:WP_028489372.1 Length = 358 Score = 439 bits (1130), Expect = e-128 Identities = 219/356 (61%), Positives = 269/356 (75%), Gaps = 5/356 (1%) Query: 81 VEVDLGTRSYPIYIGAGLLDQPDLLQRHIHGKRVLVVTNTTVAPLYLDKTISALTDGNPN 140 + ++LG RSYPI+IG GLL Q +L+ HI G +VV+NTTVAPLYL LT Sbjct: 4 LNLELGERSYPIHIGQGLLQQAELVTPHIKGNSAVVVSNTTVAPLYLTAVQQMLT----G 59 Query: 141 VTVESVILPDGEQFKNMETLMKVFDKAIESRLDRRCTFVALGGGVIGDMCGYAAASYLRG 200 + +V LPDGE +KN++ L +++ +ES+ DR+ T +ALGGGV+GDM GYAAASY RG Sbjct: 60 LKHSTVTLPDGEAYKNLDVLNQIYTHLLESKADRKTTLIALGGGVVGDMAGYAAASYQRG 119 Query: 201 VNFIQIPTTVMAQVDSSVGGKTGINHPLGKNMIGAFYQPQCVLIDTDTLNTLPDRELASG 260 +NFIQIPTT++A VDSSVGGKTG+NHPLGKNMIGAF+QPQCVLIDTDTLNTLPDREL++G Sbjct: 120 INFIQIPTTLLAMVDSSVGGKTGVNHPLGKNMIGAFHQPQCVLIDTDTLNTLPDRELSAG 179 Query: 261 LAEVIKYGLIRDAEFFEWQEQNMPLLLARDPTAFTYAIKRSCENKADVVSQDEKESGVRA 320 +AEV+KYGLIRD F +W + NM LLARDP A TYAI RSCE+KA+VV+ DE+ESG RA Sbjct: 180 IAEVVKYGLIRDPAFLQWLDANMDKLLARDPEALTYAIFRSCEHKAEVVAADERESGQRA 239 Query: 321 TLNLGHTFGHAVETGVGYGQWLHGEAVAAGTVMAVDMSRRLGWIDDSLVQRVQKILQQAK 380 LNLGHTFGHA+E +GYG WLHGEAVA G VMA ++S+++GW+ V + ILQ+A Sbjct: 240 LLNLGHTFGHAIEAAMGYGNWLHGEAVATGMVMAAELSQQMGWLAADDVAYTRHILQRAN 299 Query: 381 LPTSPPETMTVEMFKSIMAVDKKVADGKLRLILLKGSLGNCVFTGDYDQKALDETL 436 LP PP MT E F M+VDKKV DG LRLIL+K SLG + T D+D AL L Sbjct: 300 LPVVPPAQMTGEDFTRYMSVDKKVLDGTLRLILMK-SLGESIVTADFDPAALKRVL 354 Lambda K H 0.318 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 358 Length adjustment: 31 Effective length of query: 411 Effective length of database: 327 Effective search space: 134397 Effective search space used: 134397 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_028489372.1 Q394_RS0111240 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.17620.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-123 396.6 0.0 5.8e-123 396.4 0.0 1.0 1 lcl|NCBI__GCF_000621325.1:WP_028489372.1 Q394_RS0111240 3-dehydroquinate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000621325.1:WP_028489372.1 Q394_RS0111240 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 396.4 0.0 5.8e-123 5.8e-123 1 340 [. 13 351 .. 13 355 .. 0.96 Alignments for each domain: == domain 1 score: 396.4 bits; conditional E-value: 5.8e-123 TIGR01357 1 ykvkvgegllkklveelae.kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletv 68 y++++g+gll+++ + + k +++vv+++ +v+ l+ + ++++l g ++ ++++pdge +K+l+++ lcl|NCBI__GCF_000621325.1:WP_028489372.1 13 YPIHIGQGLLQQAELVTPHiKGNSAVVVSNTTVAPLYLTAVQQMLT--GLKHSTVTLPDGEAYKNLDVL 79 689********8755555556699*********************5..8******************** PP TIGR01357 69 aklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplg 137 +++++ lle+k++rk++l+a+GGGvvgD+aG++Aa+y+RGi+++q+PTtllamvDssvGGKtg+n+plg lcl|NCBI__GCF_000621325.1:WP_028489372.1 80 NQIYTHLLESKADRKTTLIALGGGVVGDMAGYAAASYQRGINFIQIPTTLLAMVDSSVGGKTGVNHPLG 148 ********************************************************************* PP TIGR01357 138 kNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeel 206 kN+iGaf+qP+ Vlid+++l+tlp+rel++G+aEv+K+gli d +++++l n ++ll ++ eal+ + lcl|NCBI__GCF_000621325.1:WP_028489372.1 149 KNMIGAFHQPQCVLIDTDTLNTLPDRELSAGIAEVVKYGLIRDPAFLQWLDANMDKLLARD-PEALTYA 216 *******************************************************999865.5****** PP TIGR01357 207 ikrsievKaevVeeDekesglRalLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgllka 274 i+rs+e KaevV++De+esg RalLN+GHt+gHaiEa+++y+ + HGeaVa+Gmv++a+ls+++g l a lcl|NCBI__GCF_000621325.1:WP_028489372.1 217 IFRSCEHKAEVVAADERESGQRALLNLGHTFGHAIEAAMGYGnWLHGEAVATGMVMAAELSQQMGWLAA 285 ********************************************************************* PP TIGR01357 275 ellerlvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasevteeell 340 +++ ++++l++++lp+ + +++ e ++++++ DKK +++++l+l++++G+ +++ +++ +l+ lcl|NCBI__GCF_000621325.1:WP_028489372.1 286 DDVAYTRHILQRANLPVVPPAQMTGEDFTRYMSVDKKVLDGTLRLILMKSLGESIVTADFDPAALK 351 *****************************************************9999888666555 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.03 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory