Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_038141826.1 Q394_RS0115905 O-succinylhomoserine sulfhydrylase
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_000621325.1:WP_038141826.1 Length = 394 Score = 514 bits (1323), Expect = e-150 Identities = 240/383 (62%), Positives = 312/383 (81%), Gaps = 1/383 (0%) Query: 19 FDTLAVRAGQRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGNVYSRYTNPTVRTF 78 F TLA+RAG RT EGEH EA+F TSS+VF +AA+AAARF G+ PGN+Y+R+TNPTVR F Sbjct: 9 FATLAIRAGHERTNEGEHSEAIFPTSSFVFGSAAEAAARFGGQEPGNIYARFTNPTVRYF 68 Query: 79 EERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGI 138 +ER+AALEG E VAT+SGMSAILA+++ L +GDHV+ SR+VFG+T L Y +FG+ Sbjct: 69 QERLAALEGGESCVATSSGMSAILAVMLGLLKAGDHVVCSRAVFGTTTLLLQNYIGKFGV 128 Query: 139 QVDYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLAVDNCFC 198 + + L+D+ AWEAA +PNT+L F E+P+NPL E+VDI ALA++AH +LL +DNCFC Sbjct: 129 AISFVDLTDMEAWEAALQPNTRLLFAETPANPLTEIVDIRALADLAHRNNSLLVIDNCFC 188 Query: 199 TPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQM-KEVVGFLRTAGPTLSPFN 257 TPALQ+PL LGAD+V+HSATKY+DGQGR +GG V G E++ K+V G LRT G T+SPFN Sbjct: 189 TPALQRPLALGADIVVHSATKYLDGQGRALGGAVVGDAERVGKDVYGVLRTGGVTMSPFN 248 Query: 258 AWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQQSGFG 317 AW+FLKGLETL +RM+AH +A+ LA+WL P +E+VYY GL SHPQH LA++QQSGFG Sbjct: 249 AWIFLKGLETLDLRMKAHCDNAMQLAQWLAAHPAVEQVYYPGLASHPQHALAQQQQSGFG 308 Query: 318 AVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAGIGD 377 +VSF +KGG++AAW+ ID+T+M+SIT NLGDTKTTI HPATT+HGRL+PE +A++GI D Sbjct: 309 GLVSFVLKGGKEAAWKVIDSTQMLSITANLGDTKTTITHPATTTHGRLTPEQKAQSGIAD 368 Query: 378 SLIRVAVGLEDLDDLKADMARGL 400 L+RV+VGLE + D++ D+ARGL Sbjct: 369 GLVRVSVGLESIRDIQRDLARGL 391 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 474 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 394 Length adjustment: 31 Effective length of query: 372 Effective length of database: 363 Effective search space: 135036 Effective search space used: 135036 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory