Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_028489050.1 Q394_RS0109310 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000621325.1:WP_028489050.1 Length = 389 Score = 243 bits (619), Expect = 9e-69 Identities = 136/377 (36%), Positives = 195/377 (51%), Gaps = 2/377 (0%) Query: 11 VPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGI 70 + PF+VM + A +R+ D++++ G+P P P+ A AL Q Y+ A G+ Sbjct: 13 IQPFHVMALLAEARQREAAGQDIIHMEVGEPDFPTPAPIVEAGIRALQSGQTKYTAARGL 72 Query: 71 PELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRN 130 P LR+AIAA Y R G+ + P+ ++IT G+SG L A + GD V M PGYPC R+ Sbjct: 73 PPLREAIAAYYASRFGVNISPERILITPGASGALQLVLGALLNPGDEVLMTDPGYPCNRH 132 Query: 131 ILSALGCEVVEIPCGPQTRFQPT-AQMLAEIDPPLRGVVVASPANPTGTVIPPEELAAIA 189 + + IP T +Q A + + + V++A+PANPTGTV+ +LA I Sbjct: 133 FVRLFEGKATAIPVDAATDYQLNRAHVQEHWNTATKAVLLATPANPTGTVLTLPQLADIH 192 Query: 190 SWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVP 249 + LI DE+Y GL Y G P T+ N V+NSFSKY+ MTGWRLGW++ P Sbjct: 193 AAVRQRGGELIVDEIYQGLTY-GIPDTTALSVDPDNLWVINSFSKYFGMTGWRLGWVVAP 251 Query: 250 TVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIG 309 +D L N + +Q AA++AFTPEA A + R LL LR +G Sbjct: 252 EWAVETLDRLAQNIFLAASTPAQYAALAAFTPEALAIMEAQRQELQQRRDFLLPALRELG 311 Query: 310 IDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAG 369 GAFY+YA F D+ C +L TGV PGIDF + + + VR ++ Sbjct: 312 FAVRTEPQGAFYLYAGSERFGEDAQRLCRDMLDQTGVVFTPGIDFGSHQANTHVRFAYTT 371 Query: 370 PSGDIEEALRRIGSWLP 386 +E+A+ R+ LP Sbjct: 372 GVARLEQAVERLAHCLP 388 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 389 Length adjustment: 30 Effective length of query: 358 Effective length of database: 359 Effective search space: 128522 Effective search space used: 128522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory