Align shikimate kinase (EC 2.7.1.71) (characterized)
to candidate WP_051956030.1 DL88_RS15130 hypothetical protein
Query= reanno::Caulo:CCNA_03103 (200 letters) >NCBI__GCF_000745425.1:WP_051956030.1 Length = 190 Score = 129 bits (325), Expect = 3e-35 Identities = 73/169 (43%), Positives = 102/169 (60%) Query: 29 LRAKTIVLVGLMGVGKSSVGRRLANVLGLPFRDADNEVEAAAGRSISEIFAELGEPAFRD 88 L ++++LVG+MG KSS+GRRLA L F D+D+ VE AA S+ EIFA GE FR Sbjct: 18 LGERSVILVGMMGADKSSIGRRLARDLNRRFLDSDSAVEEAARLSVKEIFALYGEDHFRA 77 Query: 89 GERRVIARLLDEPPHVLATGGGAFVNAETRALINEKAVSVWLKADVELLARRVSRKDNRP 148 E RV+ R+L P V+A GGGA++NA+ RA+ SVWL D+ +LA+RV+R+ RP Sbjct: 78 CELRVVERILTAPGQVVALGGGAWMNADIRAMTRSIGFSVWLDVDLSILAQRVARRRTRP 137 Query: 149 LVRGKDPVKVLTELAEARYPAYAEAQVHVETGDTPHMVAVEAILTALRQ 197 L+ + + L L E R P Y A + V +T V V ++T + Q Sbjct: 138 LLLAGNVRQSLEILNERRRPIYGTADIRVAADETHPDVIVHRMMTEIIQ 186 Lambda K H 0.316 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 92 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 200 Length of database: 190 Length adjustment: 20 Effective length of query: 180 Effective length of database: 170 Effective search space: 30600 Effective search space used: 30600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory