Align aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_034999545.1 DL88_RS18515 aspartate/tyrosine/aromatic aminotransferase
Query= BRENDA::P04693 (397 letters) >NCBI__GCF_000745425.1:WP_034999545.1 Length = 406 Score = 355 bits (912), Expect = e-102 Identities = 188/398 (47%), Positives = 252/398 (63%), Gaps = 7/398 (1%) Query: 2 FQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARL--NAQ 59 F V+ DP+L + E F D KVNL +G+Y EDG +P L V +AE L Sbjct: 4 FAHVELLPRDPVLGITEAFVADTTPTKVNLGVGVYLGEDGRVPLLDCVRQAEEELLRRKA 63 Query: 60 PHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYF 119 PHG Y P++G+ Y A+ L+FG++ P L +R+ T+Q LGG+GAL++GAD L+ Sbjct: 64 PHG---YSPIDGIAAYNSAVGSLIFGSERPNL-DERMLTVQALGGTGALRLGADLLRITN 119 Query: 120 PESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLH 179 P + V++SDP+WENH A+F+ AGF V YP+Y +A V F L+ TL TLPA IV+LH Sbjct: 120 PSARVFISDPSWENHRALFSAAGFTVEAYPYY-KADGTVDFAGLMQTLGTLPAGEIVVLH 178 Query: 180 PCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPA 239 CCHNPTG DL QW + E++ R LIPFLD AY GF G++ D AI A +G+P Sbjct: 179 ACCHNPTGVDLDPGQWGEIQELMAKRGLIPFLDAAYIGFADGLDADRRAIDLFARSGMPF 238 Query: 240 LVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVL 299 LVS SFSK SLYGERVG L+V+ A VL Q+K R YSSP G +VA +L Sbjct: 239 LVSFSFSKSLSLYGERVGALAVVTGSAAERAPVLSQVKRIARTTYSSPATHGGAIVATIL 298 Query: 300 NDEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQV 359 + L A W E+ MR RI MR+ L L+T++P R+F++++ QRGMFSY+GLS V Sbjct: 299 GEPGLTALWHDELALMRDRIKTMREGLATRLNTQLPGRDFNFIVYQRGMFSYSGLSKTAV 358 Query: 360 DRLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397 + LR++F +Y + SGR+CVA LN AN+ VA+A A V+ Sbjct: 359 EALRQQFSIYALDSGRICVAALNKANLDYVAEAIAKVL 396 Lambda K H 0.320 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 406 Length adjustment: 31 Effective length of query: 366 Effective length of database: 375 Effective search space: 137250 Effective search space used: 137250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory