Align Cystathionine beta-lyase; CBL; Beta-cystathionase; Cysteine lyase; Cysteine-S-conjugate beta-lyase; Osteotoxin; EC 4.4.1.13 (characterized)
to candidate WP_038210319.1 Q392_RS17010 cystathionine beta-lyase
Query= SwissProt::Q07703 (396 letters) >NCBI__GCF_000745855.1:WP_038210319.1 Length = 393 Score = 247 bits (630), Expect = 5e-70 Identities = 163/384 (42%), Positives = 211/384 (54%), Gaps = 16/384 (4%) Query: 23 PDTGAAPVNLPSV-RASTVRFQSLAKLEDAQRRKAAGERASTYGRMGMDTHAALEQVFAE 81 PD+ AAP P V +ASTV F+ +A + R AG TYG G T LE+ A Sbjct: 16 PDSFAAPQ--PGVFKASTVFFKDVAAMRARDWRSKAGY---TYGLHGTPTTFLLEERLAT 70 Query: 82 LEGGTHCYLASSGLAGISMVFLSLLSAGEHALVADCAYGPVHELHEAVLSRLGIDVTFFD 141 LEGGT C L SGLA IS+V L+LL G+ L+ D AYGP L L+ GI +D Sbjct: 71 LEGGTACLLVPSGLAAISLVSLALLKRGDEVLIPDNAYGPNKALATGELANFGITHRLYD 130 Query: 142 AK--ADLASLVRPTTRLIFAEAPGSLLFEMLDMPALARFAKQHDLILATDNTWGSGYIYR 199 A ADLA + TRL++ EAPGS+ E D+PAL + + A DNTWG+G + Sbjct: 131 AMDPADLAGKLSERTRLVWLEAPGSVTMEFPDLPALVAACRARGVTTALDNTWGAGLAFD 190 Query: 200 PLTLGAQVSVIAGTKYVGGHSDLMLGAVVTNDEAIAKRLNRTQYALGYSVSADDAWLALR 259 P LGA VSV A TKY G D+++G+VVT D+A+ +L T LG+ V A+D LR Sbjct: 191 PFALGADVSVHALTKYPSGGGDVLMGSVVTRDDALHLKLKLTHMRLGFGVGANDVESLLR 250 Query: 260 GVRTMPVRMAQHARHALEVCEFLQNRPEVVRLYHPAWPADPGHALWQRDCSGSN---GML 316 + ++P+R A H R A E+ +L+ R EV ++ HPA PGHA W+ C N G+ Sbjct: 251 SLPSLPLRYAAHDRAARELACWLEGREEVAQVLHPALEDSPGHAHWRALCGERNLAAGLF 310 Query: 317 AVQLG--LSPQAARDFVNALTLFGIGFSWGGFESLVQLVTPGEL--ARHQYWQGGSDALV 372 +V +A F ++L LF +G+SWGG SLV G + A W LV Sbjct: 311 SVVFDERFGTEAVDGFCDSLALFRLGYSWGGPVSLVVPYDIGLMRDASVSRWP-HKGTLV 369 Query: 373 RLHIGLESPADLIADLAQALDRAA 396 R IGLE DL ADLAQAL R A Sbjct: 370 RFSIGLEDVDDLRADLAQALARMA 393 Lambda K H 0.321 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 393 Length adjustment: 31 Effective length of query: 365 Effective length of database: 362 Effective search space: 132130 Effective search space used: 132130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory