Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_051953201.1 Q392_RS09580 3-phosphoserine/phosphohydroxythreonine transaminase
Query= BRENDA::P23721 (362 letters) >NCBI__GCF_000745855.1:WP_051953201.1 Length = 355 Score = 337 bits (865), Expect = 2e-97 Identities = 184/357 (51%), Positives = 232/357 (64%), Gaps = 12/357 (3%) Query: 14 LPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDLLNVPSNYKVLFCH 73 +P VL+QA ++ DW G G SVME+SHRGKEF + ++AE+DFR LL VP + VLF Sbjct: 1 MPEAVLRQAAADMLDWQGSGMSVMEMSHRGKEFGTIRDQAEQDFRALLAVPDEFHVLFMQ 60 Query: 74 GGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFDAKVTVDGLRAVKP 133 GGG G+ A VPLN L D+V G W+A + KEA++YC V A D P Sbjct: 61 GGGLGENAIVPLN-LSRGAGVDFVVTGSWSAKSQKEAQRYCRARV--AASNADSRHTALP 117 Query: 134 M-REWQLSDNAAYMHYCPNETIDGIAIDETPDF---GADVVVAADFSSTILSRPIDVSRY 189 WQL +AAY+H C NETI G+ E PD G+ + DFSS + SR +D R Sbjct: 118 APSSWQLDPDAAYVHLCSNETIHGVEFQELPDLQALGSRAPLVIDFSSHVASRRVDWRRV 177 Query: 190 GVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSMFNTPPTFAWYLS 249 G+ + GAQKN+GPAGLTIV+VR++LL +A CPS +Y ++ DN SM+NTPPT+ Y++ Sbjct: 178 GLAFGGAQKNLGPAGLTIVVVRDELLDRALEICPSAFNYRLVADNHSMYNTPPTWGIYMA 237 Query: 250 GLVFKWLKANG-----GVAEMDKINQQKAELLYGVIDNSDFYRNDVAKANRSRMNVPFQL 304 GL F+WL A GV M + N++KAELLYG ID S FY N+VA RSRMNVPF L Sbjct: 238 GLTFRWLLAQAEGDLRGVDAMAERNRRKAELLYGYIDASPFYFNEVAPECRSRMNVPFFL 297 Query: 305 ADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEFERRH 361 D + + FLE + AGL LKGH+ VGGMRASIYNAMPLEGV+AL +M EFER H Sbjct: 298 RDESRNADFLEGARQAGLLQLKGHKSVGGMRASIYNAMPLEGVQALVSYMREFERLH 354 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 355 Length adjustment: 29 Effective length of query: 333 Effective length of database: 326 Effective search space: 108558 Effective search space used: 108558 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_051953201.1 Q392_RS09580 (3-phosphoserine/phosphohydroxythreonine transaminase)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.12353.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-139 450.1 0.0 2.7e-139 450.0 0.0 1.0 1 lcl|NCBI__GCF_000745855.1:WP_051953201.1 Q392_RS09580 3-phosphoserine/pho Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745855.1:WP_051953201.1 Q392_RS09580 3-phosphoserine/phosphohydroxythreonine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 450.0 0.0 2.7e-139 2.7e-139 11 358 .] 1 354 [. 1 354 [. 0.97 Alignments for each domain: == domain 1 score: 450.0 bits; conditional E-value: 2.7e-139 TIGR01364 11 lpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlflqGGattqfaa 79 +pe+vl++a++++ld++g+g+svme+sHR kef ++ ++ae+d+r Ll +pd+++vlf+qGG+ ++ a lcl|NCBI__GCF_000745855.1:WP_051953201.1 1 MPEAVLRQAAADMLDWQGSGMSVMEMSHRGKEFGTIRDQAEQDFRALLAVPDEFHVLFMQGGGLGENAI 69 89******************************************************************* PP TIGR01364 80 vplnllkekkvadyivtGawskkalkeakkltkevkvvaseeekkyskipdeeelelkedaayvylcan 148 vplnl + +d++vtG+ws+k+ kea+++++ ++v+as++++ ++++p ++++l++daayv+lc+n lcl|NCBI__GCF_000745855.1:WP_051953201.1 70 VPLNLSRGA-GVDFVVTGSWSAKSQKEAQRYCR-ARVAASNADSRHTALPAPSSWQLDPDAAYVHLCSN 136 *****9977.79********************9.999999999************************** PP TIGR01364 149 etieGvefkelpevkk....aplvaDlssdilsrkidvskygliyaGaqKniGpaGvtvvivrkdller 213 eti+Gvef+elp+ + aplv D+ss++ sr++d + gl ++GaqKn+GpaG+t+v+vr++ll+r lcl|NCBI__GCF_000745855.1:WP_051953201.1 137 ETIHGVEFQELPDLQAlgsrAPLVIDFSSHVASRRVDWRRVGLAFGGAQKNLGPAGLTIVVVRDELLDR 205 ************998888889************************************************ PP TIGR01364 214 akkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekG.....GvkklekknqeKakllYeaid 277 a +++ps ++Y+ +a+n+s+yntppt++iy++gl+++wl+++ Gv++++++n++Ka+llY +id lcl|NCBI__GCF_000745855.1:WP_051953201.1 206 ALEICPSAFNYRLVADNHSMYNTPPTWGIYMAGLTFRWLLAQAegdlrGVDAMAERNRRKAELLYGYID 274 ***************************************9874447779******************** PP TIGR01364 278 esegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsvGGiRasiYnalpleevqa 346 +s fy n+v++++Rs+mnv+F l++e ++ Fl+ a+++gl++lkGh+svGG+RasiYna+ple+vqa lcl|NCBI__GCF_000745855.1:WP_051953201.1 275 ASP-FYFNEVAPECRSRMNVPFFLRDESRNADFLEGARQAGLLQLKGHKSVGGMRASIYNAMPLEGVQA 342 997.***************************************************************** PP TIGR01364 347 LvdfmkeFekkh 358 Lv++m+eFe+ h lcl|NCBI__GCF_000745855.1:WP_051953201.1 343 LVSYMREFERLH 354 ********9865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (355 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.46 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory