Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25); 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate WP_035240985.1 Q366_RS16535 shikimate dehydrogenase
Query= BRENDA::Q6PUG0 (521 letters) >NCBI__GCF_000745975.1:WP_035240985.1 Length = 267 Score = 186 bits (472), Expect = 9e-52 Identities = 103/282 (36%), Positives = 157/282 (55%), Gaps = 20/282 (7%) Query: 236 MDTDTKVFGLISKPVGHSKGPILHNPTFRHVGYNGIYVPMFVDDLKEFFRVYSSPDFAGF 295 +D T+++ + PV HSKGP++HN F++ G N +Y+ V D + + D G Sbjct: 2 IDAATRLYCVFGNPVRHSKGPLIHNAAFKNKGINAVYLAFEVQDAAGAVQAVRTLDIQGA 61 Query: 296 SVGIPYKEAVVSFCDEVDPLAKSIGAVNTIIQRPCDGKLIGYNTDCEASITAIEDALKVN 355 SV IP+KE+++ D +DP A++IGAVNTI+ +G L GYNTDC+A++ Sbjct: 62 SVTIPFKESIMKHLDWIDPTARAIGAVNTIVNE--NGILKGYNTDCQAAV---------- 109 Query: 356 GLTNGAAFLPSPLAGKLFVLVGAGGAGRALAFGAKSRRAEIVIFDIDFDRAKALAAAVSG 415 A +P ++GK +VGAGGA RA+A G ++ I+I + + KALA V+ Sbjct: 110 -----APLVPFGVSGKTVCIVGAGGAARAVAHGVAAQNGNIIITNRTEQKGKALAETVNA 164 Query: 416 EALPFENLASFQPEKGAILANATPIGMHPNKDRIPVSEASLKDYVVVFDAVYTPRKTTLL 475 +P +A+ Q + ++ N T IGM P ++ I +L +VV D VYTP +T LL Sbjct: 165 RFIPANEMANIQAD---VVINTTSIGMVPKENGISFPPEALTSDMVVMDVVYTPLRTRLL 221 Query: 476 KDAEAAGAITVSGVEMFLRQAIGQFHLFTRTKAPEEFMRDIV 517 AE G T+ G+ MF+ QA QF L+T + MR+I+ Sbjct: 222 DAAEQKGCTTIDGLSMFIAQATAQFELWTDMTPDTDLMRNII 263 Lambda K H 0.320 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 521 Length of database: 267 Length adjustment: 30 Effective length of query: 491 Effective length of database: 237 Effective search space: 116367 Effective search space used: 116367 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory