Align aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) (characterized)
to candidate WP_035239144.1 Q366_RS11925 aspartate-semialdehyde dehydrogenase
Query= BRENDA::Q9KQG2 (370 letters) >NCBI__GCF_000745975.1:WP_035239144.1 Length = 368 Score = 504 bits (1297), Expect = e-147 Identities = 239/366 (65%), Positives = 295/366 (80%) Query: 2 RVGLVGWRGMVGSVLMQRMVEERDFDLIEPVFFSTSQIGVPAPNFGKDAGMLHDAFDIES 61 +VG+VGWRGMVGSVLM+RM + DF PVFF+TSQ G PAP+ G+ A L DAFDI++ Sbjct: 3 KVGIVGWRGMVGSVLMERMSSQNDFQKFTPVFFTTSQAGQPAPDVGRGASNLIDAFDIDT 62 Query: 62 LKQLDAVITCQGGSYTEKVYPALRQAGWKGYWIDAASTLRMDKEAIITLDPVNLKQILHG 121 L ++D ++TCQGGSYTE V P L + GW G+WIDAASTLRMD ++II LDPVNL I Sbjct: 63 LMEMDILVTCQGGSYTEAVRPKLAERGWNGFWIDAASTLRMDGQSIIVLDPVNLPVIEEA 122 Query: 122 IHHGTKTFVGGNCTVSLMLMALGGLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVI 181 I G K F+GGNCTVSLMLMALGGL+E VEWM++MTYQAASGAGA+NMREL++QM I Sbjct: 123 ISRGIKNFIGGNCTVSLMLMALGGLFENDWVEWMTSMTYQAASGAGAKNMRELVAQMRTI 182 Query: 182 NDAVSSELANPASSILDIDKKVAETMRSGSFPTDNFGVPLAGSLIPWIDVKRDNGQSKEE 241 D + L NPA++ILD+D+KV +T+RS ++P +N+GVPL SLIPWID DNGQ++EE Sbjct: 183 GDQAAPILDNPAAAILDLDQKVTDTLRSDAYPVENWGVPLGASLIPWIDRAMDNGQTREE 242 Query: 242 WKAGVEANKILGLQDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDW 301 WK VE NKILG D+P+PIDG C+RIG+MRCHSQA TIKLK+++PLDEI +A +NDW Sbjct: 243 WKGFVETNKILGRSDNPIPIDGQCIRIGSMRCHSQAFTIKLKKDVPLDEINAALAANNDW 302 Query: 302 VKVIPNERDITARELTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAAEPLRR 361 V+VIPN ++ + RELTPA VTGTL+VPVGR+RKM +G++FL AF+VGDQLLWGAAEPLRR Sbjct: 303 VRVIPNNKEDSIRELTPAAVTGTLNVPVGRIRKMNIGENFLTAFSVGDQLLWGAAEPLRR 362 Query: 362 TLRIIL 367 L IIL Sbjct: 363 ILNIIL 368 Lambda K H 0.319 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 484 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 368 Length adjustment: 30 Effective length of query: 340 Effective length of database: 338 Effective search space: 114920 Effective search space used: 114920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_035239144.1 Q366_RS11925 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01745 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01745.hmm # target sequence database: /tmp/gapView.5124.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01745 [M=366] Accession: TIGR01745 Description: asd_gamma: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-179 583.1 0.3 1.1e-179 583.0 0.3 1.0 1 lcl|NCBI__GCF_000745975.1:WP_035239144.1 Q366_RS11925 aspartate-semialdeh Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745975.1:WP_035239144.1 Q366_RS11925 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 583.0 0.3 1.1e-179 1.1e-179 1 365 [. 2 367 .. 2 368 .] 0.99 Alignments for each domain: == domain 1 score: 583.0 bits; conditional E-value: 1.1e-179 TIGR01745 1 kkvglvgwrgmvgsvllkrmqeekdfdaikpvffstsqlgqkapslakisailedaydidalkeldiii 69 kkvg+vgwrgmvgsvl++rm ++df++ pvff+tsq+gq ap +++ ++ l da+did+l e+di++ lcl|NCBI__GCF_000745975.1:WP_035239144.1 2 KKVGIVGWRGMVGSVLMERMSSQNDFQKFTPVFFTTSQAGQPAPDVGRGASNLIDAFDIDTLMEMDILV 70 69******************************************************************* PP TIGR01745 70 tcqggdytkeiypklrkagwkgywidaasslrmkddaviildpvnldvikdavnkgirtfvggnctvsl 138 tcqgg+yt+ + pkl + gw+g+widaas+lrm+ +++i+ldpvnl vi++a+++gi++f+ggnctvsl lcl|NCBI__GCF_000745975.1:WP_035239144.1 71 TCQGGSYTEAVRPKLAERGWNGFWIDAASTLRMDGQSIIVLDPVNLPVIEEAISRGIKNFIGGNCTVSL 139 ********************************************************************* PP TIGR01745 139 llmslgglfrdelvewvsvatyqaasgggarhmrellkqmgvlykeveeelakpssaileierkvtkls 207 +lm+lgglf+++ vew++++tyqaasg+ga+ mrel+ qm ++ + + l +p+ ail++++kvt + lcl|NCBI__GCF_000745975.1:WP_035239144.1 140 MLMALGGLFENDWVEWMTSMTYQAASGAGAKNMRELVAQMRTIGDQAAPILDNPAAAILDLDQKVTDTL 208 ********************************************************************* PP TIGR01745 208 rseelpvenfsvplagslipwidkqldngqsreewkgqaetnkilgtkd.tilvdglcvrigalrchsq 275 rs+ pven++vpl +slipwid+ +dngq+reewkg etnkilg +d i++dg c+rig++rchsq lcl|NCBI__GCF_000745975.1:WP_035239144.1 209 RSDAYPVENWGVPLGASLIPWIDRAMDNGQTREEWKGFVETNKILGRSDnPIPIDGQCIRIGSMRCHSQ 277 **********************************************87626****************** PP TIGR01745 276 altiklkkdvsleeieeiirahnkwvkvvpnereitlreltpaavtgtldipvgrlrklnmgkeylsaf 344 a+tiklkkdv+l+ei+ ++a+n+wv+v+pn++e+++reltpaavtgtl++pvgr+rk+n+g+++l+af lcl|NCBI__GCF_000745975.1:WP_035239144.1 278 AFTIKLKKDVPLDEINAALAANNDWVRVIPNNKEDSIRELTPAAVTGTLNVPVGRIRKMNIGENFLTAF 346 ********************************************************************* PP TIGR01745 345 tvgdqllwgaaeplrrmlril 365 vgdqllwgaaeplrr+l+i+ lcl|NCBI__GCF_000745975.1:WP_035239144.1 347 SVGDQLLWGAAEPLRRILNII 367 *******************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (366 nodes) Target sequences: 1 (368 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.39 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory