GapMind for Amino acid biosynthesis

 

Alignments for a candidate for ilvH in Desulfobacter vibrioformis DSM 8776

Align Acetolactate synthase isozyme 1 small subunit; EC 2.2.1.6; Acetohydroxy-acid synthase I small subunit; AHAS-I; ALS-I (uncharacterized)
to candidate WP_035235593.1 Q366_RS01300 acetolactate synthase small subunit

Query= curated2:P0ADG0
         (96 letters)



>NCBI__GCF_000745975.1:WP_035235593.1
          Length = 93

 Score = 85.5 bits (210), Expect = 1e-22
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 1/85 (1%)

Query: 8  NVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRLEQMIS 67
          + I+ELTVRNHPGVM+ + GLFARR FN+EGILC P  D   S + L++  D+R EQ++ 
Sbjct: 3  DTIVELTVRNHPGVMSQITGLFARRNFNLEGILCRPEGDGGLSRMRLMIYTDERTEQLVK 62

Query: 68 QIDKLEDVVKVQ-RNQSDPTMFNKI 91
          Q+ KL DV+ V  R    P+ + ++
Sbjct: 63 QLSKLYDVISVSIRQDRGPSRYRQL 87


Lambda     K      H
   0.324    0.137    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 30
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 96
Length of database: 93
Length adjustment: 10
Effective length of query: 86
Effective length of database: 83
Effective search space:     7138
Effective search space used:     7138
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.1 bits)
S2: 39 (19.6 bits)

Align candidate WP_035235593.1 Q366_RS01300 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00119.hmm
# target sequence database:        /tmp/gapView.26771.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00119  [M=158]
Accession:   TIGR00119
Description: acolac_sm: acetolactate synthase, small subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    2.3e-20   59.2   0.0    2.6e-20   59.0   0.0    1.0  1  lcl|NCBI__GCF_000745975.1:WP_035235593.1  Q366_RS01300 acetolactate syntha


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_000745975.1:WP_035235593.1  Q366_RS01300 acetolactate synthase small subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   59.0   0.0   2.6e-20   2.6e-20       3      74 ..       4      74 ..       2      82 .. 0.93

  Alignments for each domain:
  == domain 1  score: 59.0 bits;  conditional E-value: 2.6e-20
                                 TIGR00119  3 hvlsvlvenepGvLsrvsGlfarrgfniesltvgeteekdlsrmtivvegddkvveqiekqleklvdvlkv 73
                                               +++++v+n+pGv+s+++Glfarr+fn+e +      + +lsrm +++ +d+++ eq+ kql+kl dv+ v
  lcl|NCBI__GCF_000745975.1:WP_035235593.1  4 TIVELTVRNHPGVMSQITGLFARRNFNLEGILCRPEGDGGLSRMRLMIYTDERT-EQLVKQLSKLYDVISV 73
                                              58899***************************99999************99875.**************99 PP

                                 TIGR00119 74 l 74
                                              +
  lcl|NCBI__GCF_000745975.1:WP_035235593.1 74 S 74
                                              7 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (158 nodes)
Target sequences:                          1  (93 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 4.48
//
[ok]

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory