Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_036257153.1 DL86_RS00085 homoserine O-acetyltransferase
Query= SwissProt::Q9AAS1 (382 letters) >NCBI__GCF_000746085.1:WP_036257153.1 Length = 397 Score = 505 bits (1300), Expect = e-147 Identities = 243/366 (66%), Positives = 295/366 (80%), Gaps = 2/366 (0%) Query: 17 FPANEPLRLDSGGVIEGLEIAYQTYGQLNADKSNAVLICHALTGDQHVASPHPTTGKPGW 76 F A PL++D+G L IAYQTYG LNADKSNAVL+CHALTGDQHVA+ HP TGKPGW Sbjct: 25 FGAEHPLQMDAGISFSPLTIAYQTYGALNADKSNAVLVCHALTGDQHVANDHPITGKPGW 84 Query: 77 WQRLVGPGKPLDPARHFIICSNVIGGCMGSTGPASINPATGKTYGLSFPVITIADMVRAQ 136 WQ +VGPG+P+D R+F+I SNV+GGCMG+TGPAS+NP TG+ YGL P++TI DMVRAQ Sbjct: 85 WQTMVGPGRPIDTDRYFVISSNVVGGCMGTTGPASLNPTTGRPYGLDLPIVTIRDMVRAQ 144 Query: 137 AMLVSALGVETLFAVVGGSMGGMQVQQWAVDYPERMFSAVVLASASRHSAQNIAFHEVGR 196 AML+ LG++T+F VVGGSMGGMQV QW + ER+F+A+ +A+A++HS+QNIAFHEVGR Sbjct: 145 AMLIDHLGIDTIFCVVGGSMGGMQVLQWVASFQERVFAAMPIATAAKHSSQNIAFHEVGR 204 Query: 197 QAIMADPDWRGGAYAEHGVRPEKGLAVARMAAHITYLSEPALQRKFGRELQ-RDGLSWGF 255 QA+MADPDWR G Y E GV P KGLAVARMAAHITYLS+ ALQ KFGR+LQ R ++ F Sbjct: 205 QAVMADPDWRRGRYLEEGVIPTKGLAVARMAAHITYLSDEALQSKFGRKLQGRVAPTFSF 264 Query: 256 DADFQVESYLRHQGSSFVDRFDANSYLYITRAMDYFDIAASHGGVLAKAFTRARNVRFCV 315 DA+FQ+E+YLR+QG SFVDRFDANSYLY+TRA DYFD+AA + G LA AF A+ RFCV Sbjct: 265 DAEFQIENYLRYQGMSFVDRFDANSYLYVTRACDYFDLAADYDGSLALAFKGAK-TRFCV 323 Query: 316 LSFSSDWLYPTAENRHLVRALTAAGARAAFAEIESDKGHDAFLLDEPVMDAALEGFLASA 375 +SF+SDWLYPTA +R +V AL A GA +F +IE+D+GHDAFLL+ P A GFL +A Sbjct: 324 VSFNSDWLYPTAASRAIVHALNAGGASVSFVDIETDRGHDAFLLNIPEFIATSRGFLDAA 383 Query: 376 ERDRGL 381 R RGL Sbjct: 384 ARARGL 389 Lambda K H 0.321 0.135 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 397 Length adjustment: 30 Effective length of query: 352 Effective length of database: 367 Effective search space: 129184 Effective search space used: 129184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate WP_036257153.1 DL86_RS00085 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.19230.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-143 461.5 0.0 1e-142 461.3 0.0 1.0 1 lcl|NCBI__GCF_000746085.1:WP_036257153.1 DL86_RS00085 homoserine O-acetyl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000746085.1:WP_036257153.1 DL86_RS00085 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 461.3 0.0 1e-142 1e-142 2 347 .. 28 377 .. 27 381 .. 0.97 Alignments for each domain: == domain 1 score: 461.3 bits; conditional E-value: 1e-142 TIGR01392 2 eeeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.GWWdellGpgrald 69 e++l++++G s +++ay+tyG lna+++NavlvcHaltg++hva+ + + k GWW++++Gpgr++d lcl|NCBI__GCF_000746085.1:WP_036257153.1 28 EHPLQMDAGISFSPLTIAYQTYGALNADKSNAVLVCHALTGDQHVANDHPITGKpGWWQTMVGPGRPID 96 5789******************************************988866556************** PP TIGR01392 70 tsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlG 138 t+ryfv+++Nv+G+c G+tgP+s+np+tg+pyg ++P vtirD+v+aq++l+d+Lg++++++vvGgS+G lcl|NCBI__GCF_000746085.1:WP_036257153.1 97 TDRYFVISSNVVGGCMGTTGPASLNPTTGRPYGLDLPIVTIRDMVRAQAMLIDHLGIDTIFCVVGGSMG 165 ********************************************************************* PP TIGR01392 139 GmqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARm 206 Gmq+l+w++s +erv +++++at+a++s+q+iaf+ev rqa+++Dp+++ G+y ee+ P+kGLa+ARm lcl|NCBI__GCF_000746085.1:WP_036257153.1 166 GMQVLQWVASFQERVFAAMPIATAAKHSSQNIAFHEVGRQAVMADPDWRRGRYLEEGvIPTKGLAVARM 234 *********************************************************9*********** PP TIGR01392 207 lalltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdla 275 a++tY+s+e+l+++fgr+ + + ++++s+++ef++e ylryqg +fv+rFdAnsYl++t+a d++dla lcl|NCBI__GCF_000746085.1:WP_036257153.1 235 AAHITYLSDEALQSKFGRKLQGRVAPTFSFDAEFQIENYLRYQGMSFVDRFDANSYLYVTRACDYFDLA 303 ********************************************************************* PP TIGR01392 276 rgrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekv 342 +++++sl+ a+k +k++++vv+++sD+l++++ ++ +++al+a +++ ++ ie+++GHDaFll+ ++ lcl|NCBI__GCF_000746085.1:WP_036257153.1 304 ADYDGSLALAFKGAKTRFCVVSFNSDWLYPTAASRAIVHALNAGGASvsFVDIETDRGHDAFLLNIPEF 372 ******************************************9998888***************99887 PP TIGR01392 343 eelir 347 ++ r lcl|NCBI__GCF_000746085.1:WP_036257153.1 373 IATSR 377 66655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (397 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.95 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory