Align Cystathionine gamma-synthase/O-acetylhomoserine (thiol)-lyase; CGS/OAH thiolyase; O-acetylhomoserine sulfhydrylase; OAH sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_036261369.1 DL86_RS11325 hypothetical protein
Query= SwissProt::O31631 (373 letters) >NCBI__GCF_000746085.1:WP_036261369.1 Length = 393 Score = 193 bits (490), Expect = 8e-54 Identities = 117/342 (34%), Positives = 187/342 (54%), Gaps = 17/342 (4%) Query: 39 GESTGFDYVRTKNPTRQLVEDAIANLENGARGLAFSSGMAAIQ-TIMALFKSGDELIVSS 97 G S Y R NPT E IA + AFSSGM AI T++A +G+ ++ Sbjct: 54 GRSHQLIYSRGDNPTVMEFERLIAAFDGAQAARAFSSGMGAIAATVLAFVGAGERIVTIR 113 Query: 98 DLYGGTYRLFENEWKKYGLTFHYDDFSDEDCLRSKITPNTKAVFVETPTNPLMQEADIEH 157 ++Y YR+FE K+G+ Y D SD D + + + P +++E+P++ + + DI Sbjct: 114 NVYSDAYRMFELLLSKFGVRVDYVDGSDCDAIAAAL-PGASLLYLESPSSIVFELQDIAA 172 Query: 158 IARITKEHGLLLIVDNTFYTPVLQRPLELGADIVIHSATKYLGGHNDLLAGLVVVKDERL 217 +A + +EHG++ ++DN++ TP+ QRP+ G D+VIH+A+KYLGGH+D +AG+V E + Sbjct: 173 LAHLAREHGVVSVIDNSWATPLFQRPIIHGVDLVIHAASKYLGGHSDTVAGVVSGSSENI 232 Query: 218 GEEMFQHQNAIGAVLPPFDSWLLMRGMKTLSLRMRQHQANAQELAAFLEEQEEISDVLYP 277 + + +GA L P ++WLL+RG++TL+LR+ H + +A L ++ VL+P Sbjct: 233 AKINARTYPFLGAKLSPLEAWLLVRGLRTLALRLPHHMKSGLAIAERLRSHPDVQRVLHP 292 Query: 278 ------------GKGGMLSFRLQKEEWVNPFLKALKTICFAESLGGVESFITYPATQTHM 325 G G+ SF + V F+ AL+ S GG ES + PA + Sbjct: 293 VYSSHPGKATLSGFSGLFSFEVADAIDVPQFVDALRLFRLGVSWGGPESLVV-PAL-APL 350 Query: 326 DIPEEIRIAN-GVCNRLLRFSVGIEHAEDLKEDLKQALCQVK 366 +PE +A GV RL+R +G E A L +DL+QAL + + Sbjct: 351 QMPEANCLARFGVSPRLIRLHIGFEDANALWDDLQQALARAR 392 Lambda K H 0.319 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 393 Length adjustment: 30 Effective length of query: 343 Effective length of database: 363 Effective search space: 124509 Effective search space used: 124509 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory