Align branched-chain amino acid aminotransferase 2; EC 2.6.1.42 (characterized)
to candidate WP_041096436.1 SUTH_RS01185 cytochrome c550
Query= CharProtDB::CH_012531 (298 letters) >NCBI__GCF_000828635.1:WP_041096436.1 Length = 288 Score = 140 bits (352), Expect = 4e-38 Identities = 96/287 (33%), Positives = 150/287 (52%), Gaps = 14/287 (4%) Query: 6 IFLNGEFVPKDEAKVSVYDHGYLYGDGVFEGIRVYSGNVFRLREHLVRLYESAKSIMLEI 65 +F++G ++P + A VSV D G+L+GDG++E I VYS FRL +HL R+ S I L Sbjct: 5 VFIDGAWLPPEAANVSVMDRGFLFGDGIYEVIPVYSRRPFRLEQHLTRMQHSLDGIRLAN 64 Query: 66 PYSLDEITNIVVETIRQNKLSNGYIRLVVSRG---AGNLGLDPDSCTKPNVVVIAEQLSL 122 P+ LDE V + + + + I L V+RG N D+ +P V+ AE +S Sbjct: 65 PFRLDEWMGFVTQLAGEAEWDDQSIYLQVTRGPMAVRNHAFPKDA--RPTSVMFAEPMST 122 Query: 123 FPQEYYEKGIPVVTVATRRNRPDVLSPQVKSLNYLNNILVRIEAKLAGVQEALMLNDQGY 182 P E+GI V+ A R L +K+ + L N L+R A AG E ++ D G+ Sbjct: 123 PPASQREQGIAAVSAADIR----WLRCDLKTTSLLANCLLRQLAVDAGCVETVLFRD-GF 177 Query: 183 VAEGSGDNVFIVKGNKLITPPSSAGALEGITRNAILEIGEKLGYDVREELFTRHDVYVAD 242 + EGS ++F+VK L+ P + L GIT + +LE+ + G T + AD Sbjct: 178 LTEGSASSIFVVKDGVLLAPIKNHLMLPGITYDVVLELAAQHGLPHEVRDITEAETRGAD 237 Query: 243 EVFLTGTAAEVIAVTTVDGRTIGLGQT-GPHTNRL---LEEFRKLVI 285 E+++ + EV+ + +DG T+G G T GP R+ +EF+ V+ Sbjct: 238 ELWMCSSTKEVLPIVRLDGATVGAGGTPGPVFARMYAWYQEFKAKVM 284 Lambda K H 0.317 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 288 Length adjustment: 26 Effective length of query: 272 Effective length of database: 262 Effective search space: 71264 Effective search space used: 71264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory