Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate WP_044413846.1 NA59_RS13240 shikimate dehydrogenase
Query= BRENDA::Q88RQ5 (274 letters) >NCBI__GCF_000934765.1:WP_044413846.1 Length = 283 Score = 249 bits (637), Expect = 4e-71 Identities = 137/273 (50%), Positives = 185/273 (67%), Gaps = 6/273 (2%) Query: 2 DQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDE--FSDCARGFFKQGSGG-N 58 D+Y V G+PI HSKSPLIHRLFA+QT Q++ Y + +E F+ ++G G N Sbjct: 7 DKYAVVGDPIAHSKSPLIHRLFAQQTAQNIRYEAIRIDSEELSFAQAIEQLKQEGFKGLN 66 Query: 59 VTVPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELA 118 +TVP+K +AF + LT RA+ A AVNT ADG + GDNTDGAGLV D+ NA Sbjct: 67 ITVPYKVDAFEQANQLTARAQVAQAVNTFVFEADGQILGDNTDGAGLVLDIEQNAKRPFK 126 Query: 119 GKRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGF-AWL 177 +R+LI+GAGGAV+G+L+P+LA +P + IANRT ++A+ L FD P+ ASG+ A Sbjct: 127 DQRVLIIGAGGAVQGILQPLLAKQPGRVHIANRTAKRAQVLGERFDTSVPMSASGWDAIP 186 Query: 178 QEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATK-LGAAKVL 236 EP D+IIN TSASL G+LPPI++ ++ A ++ YDMMYG +PT F WA + + L Sbjct: 187 LEPFDIIINGTSASLEGKLPPISEKVLGA-HSLVYDMMYGAQPTVFMNWAKQHQPNCQTL 245 Query: 237 DGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRR 269 DGLGML QAAE+F +WRGV+PD PV+A +R+ Sbjct: 246 DGLGMLVGQAAESFALWRGVKPDIQPVIAAVRK 278 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 8 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 283 Length adjustment: 25 Effective length of query: 249 Effective length of database: 258 Effective search space: 64242 Effective search space used: 64242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_044413846.1 NA59_RS13240 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.25126.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-83 265.4 0.0 2.7e-83 265.2 0.0 1.0 1 lcl|NCBI__GCF_000934765.1:WP_044413846.1 NA59_RS13240 shikimate dehydroge Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000934765.1:WP_044413846.1 NA59_RS13240 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 265.2 0.0 2.7e-83 2.7e-83 2 268 .. 8 279 .. 7 281 .. 0.95 Alignments for each domain: == domain 1 score: 265.2 bits; conditional E-value: 2.7e-83 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveiee..lekalsgikalglkGvnvTvPfKeevl 68 ++v+G+pi+hSksplih +++q+ ++++Y a+ ++ ee + +a++++k++g+kG+n+TvP+K+ ++ lcl|NCBI__GCF_000934765.1:WP_044413846.1 8 KYAVVGDPIAHSKSPLIHRLFAQQTAQNIRYEAIRIDSEElsFAQAIEQLKQEGFKGLNITVPYKVDAF 76 59*****************************9999888875689************************* PP TIGR00507 69 ellDeieesakligavNTlk.ledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavale 135 e + +++ +a++++avNT + dg+++g+nTDg Glv ++e+ +++ +++rvliiGAGGa ++++ + lcl|NCBI__GCF_000934765.1:WP_044413846.1 77 EQANQLTARAQVAQAVNTFVfEADGQILGDNTDGAGLVLDIEQnAKRPFKDQRVLIIGAGGAVQGILQP 145 ********************66799******************9888888******************9 PP TIGR00507 136 Llka.dkeviiaNRtvekaeelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkael 203 Ll + + +v iaNRt ++a+ l er+ + + a + ++l+ +d+iin tsa+l+g++ +++++++ lcl|NCBI__GCF_000934765.1:WP_044413846.1 146 LLAKqPGRVHIANRTAKRAQVLGERFDTSVPMSASGWDAIPLEPFDIIINGTSASLEGKL--PPISEKV 212 8765489*********************999999999***********************..******* PP TIGR00507 204 lkegklvvDlvynpletpllkeakkkg..tkvidGlgMlvaQaalsFelwtgvepdvekvfealkek 268 l + +lv+D++y t+++++ak+++ ++++dGlgMlv Qaa sF lw+gv+pd++ v+ a+++ lcl|NCBI__GCF_000934765.1:WP_044413846.1 213 LGAHSLVYDMMYGAQPTVFMNWAKQHQpnCQTLDGLGMLVGQAAESFALWRGVKPDIQPVIAAVRKL 279 ************************99777*******************************9999875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (283 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.57 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory