Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_046008582.1 OLEAN_RS06670 chorismate synthase
Query= SwissProt::P12008 (361 letters) >NCBI__GCF_000967895.1:WP_046008582.1 Length = 367 Score = 531 bits (1367), Expect = e-155 Identities = 258/361 (71%), Positives = 305/361 (84%), Gaps = 3/361 (0%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 M+GNT G+ F VTTFGESHG+ALGCIVDG PPGI L EADLQHDLD R+PGTS++TTQRR Sbjct: 1 MSGNTFGKSFTVTTFGESHGIALGCIVDGCPPGIELCEADLQHDLDLRKPGTSKFTTQRR 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 EPDQVKILSGVFEG TTGT IG++IENTDQRS+DYS I D FRP HADY Y KYG RDY Sbjct: 61 EPDQVKILSGVFEGKTTGTPIGMIIENTDQRSKDYSNIADTFRPAHADYAYTHKYGFRDY 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIK--DWSQVEQNPF 178 RGGGRSSARETAMRVAAGA+AKK+L K GIE+RG L+Q+G I +D + DW++V NPF Sbjct: 121 RGGGRSSARETAMRVAAGAVAKKFLLAK-GIEVRGYLSQLGPIKIDNENFDWNEVRNNPF 179 Query: 179 FCPDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSIN 238 FCPD K+ ++ M AL+KE +S+GAK+TV A+G+ GLGEP+FDRLDA+IAHALMSIN Sbjct: 180 FCPDSTKVPEMETYMEALRKECNSVGAKITVTATGLNPGLGEPIFDRLDAEIAHALMSIN 239 Query: 239 AVKGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSI 298 AVKGVEIGDGFD VA +G+++RDE++ +GF +NH+GGI+GGIS+GQ IIAH+ALKPTSS+ Sbjct: 240 AVKGVEIGDGFDCVAQKGTEHRDEMSPEGFLANHSGGIVGGISTGQDIIAHIALKPTSSM 299 Query: 299 TVPGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADVKTDI 358 +PGR+IN GE +E++TKGRHDPCVGIRA PIAEAMLAIVLMDH LR R QNADV Sbjct: 300 AIPGRSINSAGEAIEVVTKGRHDPCVGIRATPIAEAMLAIVLMDHYLRNRGQNADVVCTT 359 Query: 359 P 359 P Sbjct: 360 P 360 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 367 Length adjustment: 29 Effective length of query: 332 Effective length of database: 338 Effective search space: 112216 Effective search space used: 112216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_046008582.1 OLEAN_RS06670 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.23770.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-139 451.1 0.1 1.4e-139 450.9 0.1 1.0 1 lcl|NCBI__GCF_000967895.1:WP_046008582.1 OLEAN_RS06670 chorismate synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000967895.1:WP_046008582.1 OLEAN_RS06670 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 450.9 0.1 1.4e-139 1.4e-139 1 350 [. 10 351 .. 10 352 .. 0.98 Alignments for each domain: == domain 1 score: 450.9 bits; conditional E-value: 1.4e-139 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 +++ttfGeSHg alg+i+dG+P+g+el e+d+q++l+ R+pg+s++t++r+E D+v+ilsGvfeGkTtG lcl|NCBI__GCF_000967895.1:WP_046008582.1 10 FTVTTFGESHGIALGCIVDGCPPGIELCEADLQHDLDLRKPGTSKFTTQRREPDQVKILSGVFEGKTTG 78 789****************************************************************** PP TIGR00033 70 aPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLke 138 +Pi ++i+N+d+rskdy++i++++RP+Hady+y++KYg++d++gggrsSaReTa+rvaaGavakk+L lcl|NCBI__GCF_000967895.1:WP_046008582.1 79 TPIGMIIENTDQRSKDYSNIADTFRPAHADYAYTHKYGFRDYRGGGRSSARETAMRVAAGAVAKKFLLA 147 *******************************************************************99 PP TIGR00033 139 tagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvv 207 +gie+ +y+++lg +++++e+++ +++ ++p++cpd ++ eme +++ ++k+ +svG++++v + lcl|NCBI__GCF_000967895.1:WP_046008582.1 148 -KGIEVRGYLSQLGPIKIDNENFDW---NEVRNNPFFCPDSTKVPEMETYMEALRKECNSVGAKITVTA 212 .88*****************99994...68889************************************ PP TIGR00033 208 snvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGi 276 +++ glGep+fd+ldae+a+al+sinAvKgveiGdGF+ + ++G e+ De+ e + +n+sGGi lcl|NCBI__GCF_000967895.1:WP_046008582.1 213 TGLNPGLGEPIFDRLDAEIAHALMSINAVKGVEIGDGFDCVAQKGTEHRDEMSPE----GFLANHSGGI 277 **************************************************88655....699******* PP TIGR00033 277 eGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladall 345 GGi++G+di +ia+Kp+++++ p ++++ +++ +tkgRhDpcv +ra+p++Eam+a+vl+d++l lcl|NCBI__GCF_000967895.1:WP_046008582.1 278 VGGISTGQDIIAHIALKPTSSMAIPGRSINSAGEAIEVVTKGRHDPCVGIRATPIAEAMLAIVLMDHYL 346 *******************************999999999***************************** PP TIGR00033 346 ekras 350 ++r++ lcl|NCBI__GCF_000967895.1:WP_046008582.1 347 RNRGQ 351 99886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (367 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.22 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory