Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate WP_050464489.1 AKL27_RS19290 phosphoserine phosphatase SerB
Query= SwissProt::Q12A06 (236 letters) >NCBI__GCF_001189915.1:WP_050464489.1 Length = 291 Score = 185 bits (470), Expect = 7e-52 Identities = 101/212 (47%), Positives = 131/212 (61%), Gaps = 4/212 (1%) Query: 21 LSDFKLIAFDMDSTLINIECVDEIADAAGRKAEVAAITEAAMRGEISDYKESLRQRVALL 80 L+ + L+ FDMDSTLINIEC+DE+AD GRKAEVAAITE AMRGE DY +S+ RV LL Sbjct: 72 LASYGLLVFDMDSTLINIECIDELADCVGRKAEVAAITERAMRGEEMDYDQSMIARVQLL 131 Query: 81 KGVSVASMDEVYRTRLRLNPGAARLVQACKDAGLKVLLVSGGFTFFTDRIRDELGIDYTR 140 +G++ + VY RL + PGA +LVQ + AGLK ++SGGF +F DR+R EL ID Sbjct: 132 RGLAARDLKRVYDERLTITPGARQLVQQARRAGLKTAIISGGFDYFADRLRAELEIDVAI 191 Query: 141 SNVLETTDGLLTGRMVDQPWGDICDGEEKRKMLLETCGQLGISPRQAIAMGDGANDLPMM 200 SN L G +TG M + P + + K + C + G++ I GDGANDL MM Sbjct: 192 SNRLSMEHGYVTGGMDNPP----VNAQVKASTVKSLCAEWGVALSDTIVAGDGANDLQMM 247 Query: 201 GEAGLSVAYHAKPRVREQAMVAINEGGLDRLL 232 AG+SV Y K V E+ + I LD +L Sbjct: 248 AIAGVSVGYRPKQIVAEKVDIQIAHLALDSVL 279 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 291 Length adjustment: 25 Effective length of query: 211 Effective length of database: 266 Effective search space: 56126 Effective search space used: 56126 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_050464489.1 AKL27_RS19290 (phosphoserine phosphatase SerB)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.18743.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-67 213.1 0.1 2.3e-67 212.8 0.1 1.0 1 lcl|NCBI__GCF_001189915.1:WP_050464489.1 AKL27_RS19290 phosphoserine phos Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001189915.1:WP_050464489.1 AKL27_RS19290 phosphoserine phosphatase SerB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 212.8 0.1 2.3e-67 2.3e-67 7 217 .. 68 280 .. 65 282 .. 0.96 Alignments for each domain: == domain 1 score: 212.8 bits; conditional E-value: 2.3e-67 TIGR00338 7 lskllkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrg.eldFkeslreRvkllkglpv 74 ++++l + +l+vfD+Dstli++E+Ide+a +G + eV++iTerAmrg e+d+++s+ Rv+ll+gl++ lcl|NCBI__GCF_001189915.1:WP_050464489.1 68 KRRVLASYGLLVFDMDSTLINIECIDELADCVGRKAEVAAITERAMRGeEMDYDQSMIARVQLLRGLAA 136 567788999**************************************9459****************** PP TIGR00338 75 ellkkve.eklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLevedgkltGk 142 +lk+v+ e+l++t+G+++lv++ +++g+k+a+iSGgFd++a++l+++L++d++++NrL++e g tG lcl|NCBI__GCF_001189915.1:WP_050464489.1 137 RDLKRVYdERLTITPGARQLVQQARRAGLKTAIISGGFDYFADRLRAELEIDVAISNRLSMEHGYVTGG 205 *****97368*********************************************************** PP TIGR00338 143 vegeivdesakaktllkllekegislektvavGDGanDlsmikaAglgiafnakpvlkekadiviekkd 211 + ++v++++ka t+++l+ + g+ l +t++ GDGanDl+m++ Ag+ +++ k+++ ek di i + lcl|NCBI__GCF_001189915.1:WP_050464489.1 206 MDNPPVNAQVKASTVKSLCAEWGVALSDTIVAGDGANDLQMMAIAGVSVGYRPKQIVAEKVDIQIAHLA 274 ******************************************************************999 PP TIGR00338 212 ltdile 217 l ++l lcl|NCBI__GCF_001189915.1:WP_050464489.1 275 LDSVLG 280 988875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (291 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.55 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory