Align L-leucine transaminase; L-isoleucine transaminase (EC 2.6.1.42) (characterized)
to candidate WP_050463335.1 AKL27_RS13385 PLP-dependent aminotransferase family protein
Query= reanno::acidovorax_3H11:Ac3H11_1358 (401 letters) >NCBI__GCF_001189915.1:WP_050463335.1 Length = 397 Score = 385 bits (988), Expect = e-111 Identities = 214/397 (53%), Positives = 263/397 (66%), Gaps = 10/397 (2%) Query: 4 NDLPQNSTWTLARRAERMNPSVIREILKVTEKPGIISLAGGLPSPKTFPVSAFAAASAAV 63 N+ P W ++R++++ S IREILKVT +P I S AGGLPSP TFPV AA V Sbjct: 3 NEHPNPIQWNFSQRSQQLQSSAIREILKVTMRPEITSFAGGLPSPATFPVEHLRAAYDKV 62 Query: 64 LANDGPAALQYAASEGYAPLRQAIADFLPWDVDA----DQILITTGSQQALDLIAKVLID 119 L+ G ALQY ++GYAPLR +AD L DA +Q+L+ +GSQQ LDL+ KVLID Sbjct: 63 LSQQGKVALQYGPTDGYAPLRAWVADSLS-TADARIVPEQVLMVSGSQQGLDLLGKVLID 121 Query: 120 ENSRVLVETPTYLGALQAFTPMEPSVVAVASDDEGVLIDDLKAKVGTGADKARFLYVLPN 179 E S+VLVETP+YLGALQAF+ P V++ SD EG L+ + A +G GA R LY LPN Sbjct: 122 EGSKVLVETPSYLGALQAFSLYGPDFVSIPSD-EGGLLPEAVATLGQGA---RLLYSLPN 177 Query: 180 FQNPTGRTMTEARRAALVKAAAELNLPLVEDNPYGDLWFDNPPPAPLTARNPEGCIYMGS 239 FQNPTGRT++ RR ALV A L LPL+ED+PYG L + N P + NP G IYMGS Sbjct: 178 FQNPTGRTLSVERRQALVDTCARLGLPLIEDDPYGALSYRNDPLPKMLNMNPGGVIYMGS 237 Query: 240 FSKVLAPGLRLGFVVAPKAVYPKLLQAKQAADLHTPGYNQRLVAEVMKGNFLDRHVPTIR 299 FSKVL PG+RLG+VVAP + KL QAKQAADLHT Q +V E +K FL H+PTIR Sbjct: 238 FSKVLTPGIRLGYVVAPIPLIQKLEQAKQAADLHTAQLTQMVVYEAVKDGFLTSHIPTIR 297 Query: 300 ALYKQQCEAMLAALTQEMAGLGVEWNRPDGGMFLWVRLPEGMSAIELLPQAVERNVAFVP 359 LY QC+AML ALT G W +P+GGMF+WV LP + + LL +AVE+ VAFVP Sbjct: 298 KLYGDQCQAMLDALTTYFPA-GCSWTKPEGGMFIWVTLPSHIDSTALLAEAVEQLVAFVP 356 Query: 360 GAAFYADNADPRTLRLSFVTSTVEQIATGIAALAAAI 396 GA F+A+ + TLRLSFVT E+I GI L I Sbjct: 357 GAPFFANAPENNTLRLSFVTVPPEKIRAGIERLGQLI 393 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 397 Length adjustment: 31 Effective length of query: 370 Effective length of database: 366 Effective search space: 135420 Effective search space used: 135420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory