Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_057687230.1 ABB28_RS15240 chorismate synthase
Query= SwissProt::P12008 (361 letters) >NCBI__GCF_001431535.1:WP_057687230.1 Length = 367 Score = 456 bits (1172), Expect = e-133 Identities = 221/360 (61%), Positives = 278/360 (77%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 M+ N+ G+LF VTTFGESHG A+GC++DG PPG+ L A+ HDL RR G SR+T+ RR Sbjct: 1 MSSNSFGKLFTVTTFGESHGPAIGCVIDGCPPGLALDAAEFAHDLQRRATGKSRHTSARR 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 E D+V+ILSGV+EG+TTGT I LLI NTDQRS+DY+ I FRPGHADY+Y KYG+RD Sbjct: 61 EADEVEILSGVYEGLTTGTPIALLIRNTDQRSKDYANIGQQFRPGHADYSYWHKYGIRDP 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC 180 RGGGRSSARET MRVAAG +AKK+LAE+FG+ +RG L+Q+G+I DWS VE NPFF Sbjct: 121 RGGGRSSARETTMRVAAGVVAKKWLAERFGVTVRGYLSQLGEITPRAFDWSAVEDNPFFW 180 Query: 181 PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV 240 PD ++ L+ M AL++ GDS+GA+V VVA VP G GEP++ +LD ++A ALMSINAV Sbjct: 181 PDAAQVPELETYMDALRRSGDSVGARVDVVADNVPPGWGEPIYGKLDGELASALMSINAV 240 Query: 241 KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV 300 KGVEIGDGF A +G+++RD +T GF SNHAGGILGGIS+GQ + A + LKPTSS+ + Sbjct: 241 KGVEIGDGFASAAQKGTEHRDLLTPQGFASNHAGGILGGISTGQPVTASIVLKPTSSLRL 300 Query: 301 PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADVKTDIPR 360 PG +++ G +E++T GRHDPCVGIRA PIAEAM+A+VLMD LR RAQ DV + PR Sbjct: 301 PGASLDSEGNVIEVVTTGRHDPCVGIRAAPIAEAMMALVLMDQALRHRAQCGDVGSITPR 360 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 367 Length adjustment: 29 Effective length of query: 332 Effective length of database: 338 Effective search space: 112216 Effective search space used: 112216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_057687230.1 ABB28_RS15240 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.32119.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-137 442.7 0.0 5e-137 442.5 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057687230.1 ABB28_RS15240 chorismate synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057687230.1 ABB28_RS15240 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 442.5 0.0 5e-137 5e-137 1 350 [. 10 350 .. 10 351 .. 0.97 Alignments for each domain: == domain 1 score: 442.5 bits; conditional E-value: 5e-137 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 +++ttfGeSHg+a+g++idG+P+gl l++++++++l+rR g+sr+t+ r+E+DeveilsGv+eG TtG lcl|NCBI__GCF_001431535.1:WP_057687230.1 10 FTVTTFGESHGPAIGCVIDGCPPGLALDAAEFAHDLQRRATGKSRHTSARREADEVEILSGVYEGLTTG 78 789****************************************************************** PP TIGR00033 70 aPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLke 138 +Pialli+N+d+rskdy +i +++RPgHady y++KYgi+d +gggrsSaReT++rvaaG+vakk+L+e lcl|NCBI__GCF_001431535.1:WP_057687230.1 79 TPIALLIRNTDQRSKDYANIGQQFRPGHADYSYWHKYGIRDPRGGGRSSARETTMRVAAGVVAKKWLAE 147 ********************************************************************* PP TIGR00033 139 tagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvv 207 g+ + +y+++lge++ + ++ +++++p++ pda + e+e ++d ++++gdsvG++v+vv+ lcl|NCBI__GCF_001431535.1:WP_057687230.1 148 RFGVTVRGYLSQLGEITPRA--FD---WSAVEDNPFFWPDAAQVPELETYMDALRRSGDSVGARVDVVA 211 *****************996..33...467999************************************ PP TIGR00033 208 snvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGi 276 nvp g+Gep++ kld+elasal+sinAvKgveiGdGF++a ++G e+ D l + + + +n+ GGi lcl|NCBI__GCF_001431535.1:WP_057687230.1 212 DNVPPGWGEPIYGKLDGELASALMSINAVKGVEIGDGFASAAQKGTEHRDLL----TPQGFASNHAGGI 276 **************************************************33....467899******* PP TIGR00033 277 eGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladall 345 +GGi++G++++ +i++Kp+++++ p ++ d e++ +t+gRhDpcv +ra+p++Eam+alvl+d++l lcl|NCBI__GCF_001431535.1:WP_057687230.1 277 LGGISTGQPVTASIVLKPTSSLRLPGASLDSEGNVIEVVTTGRHDPCVGIRAAPIAEAMMALVLMDQAL 345 ********************************************************************* PP TIGR00033 346 ekras 350 ++ra+ lcl|NCBI__GCF_001431535.1:WP_057687230.1 346 RHRAQ 350 *9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (367 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.24 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory