Align Catabolic 3-dehydroquinate dehydratase; 3-dehydroquinase; EC 4.2.1.10 (characterized)
to candidate WP_057508481.1 ABB28_RS09905 type I 3-dehydroquinate dehydratase
Query= SwissProt::Q59087 (272 letters) >NCBI__GCF_001431535.1:WP_057508481.1 Length = 283 Score = 240 bits (612), Expect = 3e-68 Identities = 124/262 (47%), Positives = 172/262 (65%) Query: 7 STTYAAENTVPASKSTYVVKNLNIGDLPVKTLVPITAKTREQALAQAKVIAENKDADIAE 66 +T+ A P + + + IG+ KT+VPITA T EQAL QAKVIA + DIAE Sbjct: 14 ATSIPAVQAAPPAIRPLQIGTMRIGEGMPKTIVPITAATAEQALQQAKVIAASASTDIAE 73 Query: 67 FRIDLLEFASDTKKVIALGQELNQILKDKPLLATIRTSNEGGKLKVTDQEYEKIYSEYLK 126 +RID L+ A+D ++ALG+ + Q L KPL+ T RT EGG ++D +Y +Y+ L+ Sbjct: 74 WRIDYLDIATDGTALLALGKRIEQALAGKPLIVTFRTQAEGGSKAISDADYGALYATLLR 133 Query: 127 KPFMQLLDIEMFRDQAAVAKLTKLAHQKKVLVVMSNHDFDKTPSEQEIVSRLLKQDQMGA 186 F+Q+LD+EMFRD+ V L AH VVMS+HDF TP +EIV+RLL+Q MGA Sbjct: 134 GGFVQMLDVEMFRDRQVVQSLVDAAHGAGAKVVMSSHDFHATPPREEIVARLLRQQAMGA 193 Query: 187 DILKIAVMPKSKQDVFTLMNATLKVSEQSTKPLLTMSMGRLGTISRIATANMGGSLSFGM 246 D+LKIAVMP+ DV L++AT +V +QS +PLLTM+MG G +SR+A G +++FGM Sbjct: 194 DVLKIAVMPRDAGDVLALLDATWQVRQQSDRPLLTMAMGGTGVVSRLAGETFGQAMTFGM 253 Query: 247 IGEASAPGQIDVTALKQFLKTV 268 IG SAPGQ++V L+ L+ + Sbjct: 254 IGTPSAPGQVEVEQLQSVLQVI 275 Lambda K H 0.314 0.129 0.341 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 283 Length adjustment: 25 Effective length of query: 247 Effective length of database: 258 Effective search space: 63726 Effective search space used: 63726 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
Align candidate WP_057508481.1 ABB28_RS09905 (type I 3-dehydroquinate dehydratase)
to HMM TIGR01093 (aroD: 3-dehydroquinate dehydratase, type I (EC 4.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01093.hmm # target sequence database: /tmp/gapView.22122.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01093 [M=229] Accession: TIGR01093 Description: aroD: 3-dehydroquinate dehydratase, type I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-72 229.1 0.0 4.3e-72 228.9 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057508481.1 ABB28_RS09905 type I 3-dehydroqu Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057508481.1 ABB28_RS09905 type I 3-dehydroquinate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 228.9 0.0 4.3e-72 4.3e-72 1 228 [. 43 271 .. 43 272 .. 0.98 Alignments for each domain: == domain 1 score: 228.9 bits; conditional E-value: 4.3e-72 TIGR01093 1 kilvpltakdleealeelekik.evgaDivElRvDllkdvsseksveavaeqlsellkdlplilTiRtq 68 k++vp+ta ++e+al++++ i+ Di E+R+D+l+ + + + a+ + ++++l+ +pli+T+Rtq lcl|NCBI__GCF_001431535.1:WP_057508481.1 43 KTIVPITAATAEQALQQAKVIAaSASTDIAEWRIDYLDIATDGTALLALGKRIEQALAGKPLIVTFRTQ 111 689*****************9977899****************************************** PP TIGR01093 69 keGGkfkgdeeerleelkeaieknlvdlvDiElkleeeavkelikeakkaktkiilSnHdfektpskee 137 eGG+ + ++ ++ +++ ++ ++v+++D+E++++ ++v+ l+ a+ a+ k+++S+Hdf+ tp+ ee lcl|NCBI__GCF_001431535.1:WP_057508481.1 112 AEGGSKAISDADYGALYATLLRGGFVQMLDVEMFRDRQVVQSLVDAAHGAGAKVVMSSHDFHATPPREE 180 ********************************************************************* PP TIGR01093 138 lverlekaqsldaDivKiavmaksieDvltLleitlkveeekdkplialsMgekGkisRvlgavlgsvl 206 +v+rl ++q+++aD++Kiavm++++ Dvl+Ll +t +v+++ d+pl+++ Mg +G +sR++g+ +g ++ lcl|NCBI__GCF_001431535.1:WP_057508481.1 181 IVARLLRQQAMGADVLKIAVMPRDAGDVLALLDATWQVRQQSDRPLLTMAMGGTGVVSRLAGETFGQAM 249 **************************************9888*************************** PP TIGR01093 207 tfgslgkasAPGQisvkelrel 228 tfg++g sAPGQ++v++l+ + lcl|NCBI__GCF_001431535.1:WP_057508481.1 250 TFGMIGTPSAPGQVEVEQLQSV 271 *******************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (229 nodes) Target sequences: 1 (283 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 7.22 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory