Align [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (EC 2.5.1.113); O-phosphoserine sulfhydrylase (EC 2.5.1.65) (characterized)
to candidate WP_057687361.1 ABB28_RS15950 cysteine synthase A
Query= BRENDA::P9WP53 (323 letters) >NCBI__GCF_001431535.1:WP_057687361.1 Length = 319 Score = 196 bits (499), Expect = 5e-55 Identities = 126/326 (38%), Positives = 178/326 (54%), Gaps = 27/326 (8%) Query: 1 MTRYDSLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLEDRNPTGSIKDRPAVRMIE 60 M Y+S+L +GNTP+V L RL+P HV L+AK+E NP GS+KDR A+ ++ Sbjct: 1 MALYESILDTIGNTPIVKLHRLAPA--------HVTLYAKVESFNPGGSVKDRLALAIVL 52 Query: 61 QAEADGLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQI 120 AE GLL+PG TI+E TSGNTG++LAM A +GY+ + M E S+ERR+L+ YGA++ Sbjct: 53 DAEQRGLLKPGDTIIEATSGNTGVALAMVAAARGYKFVATMVETFSIERRKLMRAYGAKV 112 Query: 121 IFSAAEGGSNTAVATAKELAATNPSWVMLYQYGNPANTDSHYCGTGPELLADLP--EITH 178 I + A + V A ELA + W + Q+ NPAN H T E+L D + + Sbjct: 113 ILTPAAERGSGMVRRAAELAQEH-GWFLASQFANPANPAYHRSTTAAEILRDFAGRRLDY 171 Query: 179 FVAGLGTTGTLMGTGRFLREHVANVKIVAAEPRYGEGV--------YALRNMDEGFVPEL 230 FV+G GT GTL G G L+ +IVA EP G + + ++ FVP++ Sbjct: 172 FVSGWGTGGTLTGVGEVLKVARPQTRIVATEPA-GAALLKGDDWKPHKIQGWTPDFVPDV 230 Query: 231 YDPEILTARYSVGAVDAVRRTRELVHTEGIFAGISTGAVLHAALGVGAGALAAGERADIA 290 + ++ +V A+ R L EG+F GIS GA L +AL V A A + I Sbjct: 231 LNRNVVDELLTVEDDRAISTARRLAAEEGLFVGISAGATLASALDV---AERAEPGSVIL 287 Query: 291 LVVADAGWKYLSTGAYA----GSLDD 312 ++ D G +Y ST +A GS DD Sbjct: 288 AMLPDTGERYFSTPLFADVNEGSDDD 313 Lambda K H 0.317 0.134 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 319 Length adjustment: 28 Effective length of query: 295 Effective length of database: 291 Effective search space: 85845 Effective search space used: 85845 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory