Align O-ureido-L-serine synthase; Cysteine synthase homolog DscD; O-acetylserine sulfhydrylase; EC 2.6.99.3; EC 2.5.1.47 (characterized)
to candidate WP_057687361.1 ABB28_RS15950 cysteine synthase A
Query= SwissProt::D2Z027 (324 letters) >NCBI__GCF_001431535.1:WP_057687361.1 Length = 319 Score = 429 bits (1102), Expect = e-125 Identities = 210/318 (66%), Positives = 262/318 (82%) Query: 1 MPLFNSILDTIGRTPIVRLQRMAPEHTSVYVKVESFNPGGSVKDRLALSVVLDAEAKGLL 60 M L+ SILDTIG TPIV+L R+AP H ++Y KVESFNPGGSVKDRLAL++VLDAE +GLL Sbjct: 1 MALYESILDTIGNTPIVKLHRLAPAHVTLYAKVESFNPGGSVKDRLALAIVLDAEQRGLL 60 Query: 61 KPGDTIVECTSGNVGIALAMVAAARGYRFVAVMGDTYSVERRKLIRAYGGKLVLFPGHLG 120 KPGDTI+E TSGN G+ALAMVAAARGY+FVA M +T+S+ERRKL+RAYG K++L P Sbjct: 61 KPGDTIIEATSGNTGVALAMVAAARGYKFVATMVETFSIERRKLMRAYGAKVILTPAAER 120 Query: 121 SKGGNLIADELAEKYGWFRARQFDNPANPSYHRETTASEILADFAGKRLDHFVTGFGTTG 180 G A ELA+++GWF A QF NPANP+YHR TTA+EIL DFAG+RLD+FV+G+GT G Sbjct: 121 GSGMVRRAAELAQEHGWFLASQFANPANPAYHRSTTAAEILRDFAGRRLDYFVSGWGTGG 180 Query: 181 TLTGVGQMLRVARPEVRVVALEPSNAAMLARGEWSPHQIQGLAPNFVPGVLDRSVIDDLV 240 TLTGVG++L+VARP+ R+VA EP+ AA+L +W PH+IQG P+FVP VL+R+V+D+L+ Sbjct: 181 TLTGVGEVLKVARPQTRIVATEPAGAALLKGDDWKPHKIQGWTPDFVPDVLNRNVVDELL 240 Query: 241 TMDEVTARDTSRRLAAEEGIFAGISAGATVATALSIAEHAPEGTVLLAMLPDTGERYLST 300 T+++ A T+RRLAAEEG+F GISAGAT+A+AL +AE A G+V+LAMLPDTGERY ST Sbjct: 241 TVEDDRAISTARRLAAEEGLFVGISAGATLASALDVAERAEPGSVILAMLPDTGERYFST 300 Query: 301 FLFDGVDEGSDDAWLASL 318 LF V+EGSDD WLA L Sbjct: 301 PLFADVNEGSDDDWLAGL 318 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 319 Length adjustment: 28 Effective length of query: 296 Effective length of database: 291 Effective search space: 86136 Effective search space used: 86136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_057687361.1 ABB28_RS15950 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.11980.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-133 431.2 0.0 1.2e-133 431.0 0.0 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057687361.1 ABB28_RS15950 cysteine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057687361.1 ABB28_RS15950 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 431.0 0.0 1.2e-133 1.2e-133 2 298 .] 8 303 .. 7 303 .. 0.99 Alignments for each domain: == domain 1 score: 431.0 bits; conditional E-value: 1.2e-133 TIGR01139 2 seliGntPlvrLnlaeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGi 70 ++iGntP+v+L++ ++a++ +++k+es+nP++svkdr+ala++ dae++gllk+g+ti+eatsGntG+ lcl|NCBI__GCF_001431535.1:WP_057687361.1 8 LDTIGNTPIVKLHRLAPAHVTLYAKVESFNPGGSVKDRLALAIVLDAEQRGLLKPGDTIIEATSGNTGV 76 579**********99****************************************************** PP TIGR01139 71 alamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqf 139 alamvaaargyk+++tm+et+s+errkl++ayGa+++Lt++ae+ +g++++a el++e++ ++l++qf lcl|NCBI__GCF_001431535.1:WP_057687361.1 77 ALAMVAAARGYKFVATMVETFSIERRKLMRAYGAKVILTPAAERGSGMVRRAAELAQEHG--WFLASQF 143 ************************************************************..99***** PP TIGR01139 140 enpanpeihrkttapeilkdldgk.ldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsgg 207 +npanp++hr+tta+eil+d+ g+ ld fv+g+GtGGt+tGvgevlk ++p+ ++va+ePa +++l+g lcl|NCBI__GCF_001431535.1:WP_057687361.1 144 ANPANPAYHRSTTAAEILRDFAGRrLDYFVSGWGTGGTLTGVGEVLKVARPQTRIVATEPAGAALLKGD 212 *********************9988******************************************** PP TIGR01139 208 kpgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakkle 276 ++ phkiqG++++f+P+vL+++v+de+++v+d+ ai+tarrla+eeG++vGis+Ga++a+al va+++e lcl|NCBI__GCF_001431535.1:WP_057687361.1 213 DWKPHKIQGWTPDFVPDVLNRNVVDELLTVEDDRAISTARRLAAEEGLFVGISAGATLASALDVAERAE 281 ********************************************************************* PP TIGR01139 277 kdkkivvilpdtgerYlstaLf 298 ++ +i+++lpdtgerY+st+Lf lcl|NCBI__GCF_001431535.1:WP_057687361.1 282 PGSVILAMLPDTGERYFSTPLF 303 *********************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (319 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 10.08 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory