Align Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 (characterized)
to candidate WP_057508000.1 ABB28_RS07270 tRNA glutamyl-Q(34) synthetase GluQRS
Query= SwissProt::Q8DLI5 (485 letters) >NCBI__GCF_001431535.1:WP_057508000.1 Length = 296 Score = 156 bits (395), Expect = 8e-43 Identities = 102/281 (36%), Positives = 141/281 (50%), Gaps = 34/281 (12%) Query: 6 RLAPSPTGNLHIGTARTAVFNWLYARHRGGKFILRIEDTDRERSRPEYTENILEGLQWLG 65 R APSPTG LH G+ A +WL+A H+GG+++LR+ED D R+ P ++ L+ L +LG Sbjct: 9 RFAPSPTGPLHAGSLLAAFASWLFAHHQGGRWLLRVEDVDPPRTVPGAAQSQLDLLHYLG 68 Query: 66 LTWDEGPYFQSDRLDLYRQAIQTLLDKGLAYYCYCTPEELEALRAEQKAKGQAPRYDNRH 125 L D +QS R D+Y+ A+ LL G A+ C+C+ R+E A G Sbjct: 69 LQPDGPVLWQSRRSDVYQHALDALLASGRAFACHCS-------RSELAASGGI------- 114 Query: 126 RHLTPEEQAAFEAAGRTPVIRFKIEDDRQIEWQDLVRGRVSWQGADLGGDMVIARAAPRG 185 Q A P IR ++ + + D +RG GD V+ RA Sbjct: 115 -----HHQCVARQARPDPAIRLRVAPGSVVTFDDALRGPQRQDVHADVGDFVLRRAD--- 166 Query: 186 EIGYPLYNLVVVVDDIAMGITDVIRGEDHIGNTPKQILLYEALGATPPNFAHTPLILNST 245 G Y L VVVDD A GITDV+RG D + +T +QILL ALG P +AH PL+L Sbjct: 167 --GCWAYQLAVVVDDAAQGITDVVRGADLLDSTARQILLQRALGLPTPRYAHLPLLLAGD 224 Query: 246 GQKLSKRDGVTSISD----------FRAMGYLAPALANYMT 276 G+KLSK + ++ +R +G A ALA T Sbjct: 225 GRKLSKSEAAPTVDGGDPMAVLRQLWRLLGQPAAALAGAST 265 Lambda K H 0.320 0.136 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 296 Length adjustment: 30 Effective length of query: 455 Effective length of database: 266 Effective search space: 121030 Effective search space used: 121030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory